PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr3g058980.1 | ||||||||
Common Name | MTR_3g058980, NF-YB12 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 191aa MW: 20107.2 Da PI: 6.6795 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 183.2 | 2.2e-57 | 26 | 121 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk yl+++re+eg Medtr3g058980.1 26 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKGYLQRFREMEG 119 89******************************************************************************************** PP NF-YB 96 ek 97 ek Medtr3g058980.1 120 EK 121 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.6E-55 | 20 | 131 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.19E-40 | 28 | 128 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.2E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.5E-20 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.5E-20 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 3.5E-20 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 191 aa Download sequence Send to blast |
MADSDNDSGG PHGGGSNAHG SEMSPREQDR FLPIANVSRI MKKALPANAK ISKDAKETVQ 60 ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF EEYVEPLKGY LQRFREMEGE 120 KTVGARDKDA PQGSGSVTNS SYESGGYGGG GGVMMHQGHV YGSGGGGFHQ VMGKGGPGYP 180 GPGSNTGRPR * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-49 | 20 | 116 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mtr.14 | 0.0 | leaf| pod| root| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr3g058980.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ918285 | 0.0 | JQ918285.1 Medicago truncatula nuclear transcription factor Y subunit B12 (NF-YB12) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013460047.1 | 1e-138 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 1e-71 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | I3TAX0 | 1e-137 | I3TAX0_MEDTR; Nuclear transcription factor Y protein | ||||
STRING | GLYMA18G08620.1 | 1e-109 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47640.1 | 6e-67 | nuclear factor Y, subunit B2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr3g058980.1 |
Entrez Gene | 25489147 |
Publications ? help Back to Top | |||
---|---|---|---|
|