PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.14G121400.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 141aa MW: 16164.5 Da PI: 10.7013 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.2 | 3.8e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 r +WT+ Ed++l d++ ++G+g W++ a+++g++R++k+c++rw++yl Manes.14G121400.1.p 14 RVAWTPPEDKRLMDYISMHGPGKWERLAKELGLNRCGKSCRLRWLNYL 61 679********************************************7 PP | |||||||
2 | Myb_DNA-binding | 57.9 | 2.4e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+++++E++l+++++k+lG++ W++Ia +++ gRt++++k++w++ Manes.14G121400.1.p 67 RGKFSEDEEDLIIRLHKLLGNR-WSLIAGRIP-GRTDNEIKNHWNTC 111 89********************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.839 | 9 | 61 | IPR017930 | Myb domain |
SMART | SM00717 | 7.5E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.59E-30 | 13 | 108 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 9.1E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.39E-10 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.4E-24 | 16 | 68 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.662 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 6.2E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.2E-17 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.28E-11 | 69 | 110 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.9E-25 | 69 | 115 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MGRASTSSKE AFNRVAWTPP EDKRLMDYIS MHGPGKWERL AKELGLNRCG KSCRLRWLNY 60 LRPGIKRGKF SEDEEDLIIR LHKLLGNRWS LIAGRIPGRT DNEIKNHWNT CLAKKAKDLN 120 FTLPRLQKEK QSPSSSTSDN * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-30 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.14G121400.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021634028.1 | 1e-100 | transcription factor TT2-like | ||||
Refseq | XP_021634029.1 | 1e-100 | transcription factor TT2-like | ||||
Swissprot | Q9FJA2 | 4e-52 | TT2_ARATH; Transcription factor TT2 | ||||
TrEMBL | A0A2C9UL56 | 1e-98 | A0A2C9UL56_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_022994m | 6e-79 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35550.1 | 2e-54 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.14G121400.1.p |