PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000323779 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 248aa MW: 28589.9 Da PI: 9.2328 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 74.6 | 2.4e-23 | 2 | 59 | 70 | 128 |
NAM 70 tgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +g r+nrat sgyWkatg+dk+++s +++ vg+kk Lvfy+gr pkg+k+dW+mheyrl MDP0000323779 2 NGIRPNRATVSGYWKATGTDKAIYS-ESKYVGVKKALVFYQGRPPKGVKSDWIMHEYRL 59 789**********************.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 33.262 | 1 | 87 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 7.98E-29 | 1 | 87 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.8E-10 | 6 | 59 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 248 aa Download sequence Send to blast |
PNGIRPNRAT VSGYWKATGT DKAIYSESKY VGVKKALVFY QGRPPKGVKS DWIMHEYRLG 60 DTRKQQANKQ LGSMRLDDWV LCRIYKKRQP GKAYLDPKVE EDEKIEMTTP ETAKANEEQM 120 MLKFPRTCSI TSLLDMDYLG PMSQLLGDNN SGYDFQSSLA GAELXXXXXX XXXXXXXXXX 180 XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX 240 XXXXXXVX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-32 | 1 | 88 | 84 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-32 | 1 | 88 | 84 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-32 | 1 | 88 | 84 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-32 | 1 | 88 | 84 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-32 | 1 | 88 | 87 | 169 | NAC domain-containing protein 19 |
3swm_B | 5e-32 | 1 | 88 | 87 | 169 | NAC domain-containing protein 19 |
3swm_C | 5e-32 | 1 | 88 | 87 | 169 | NAC domain-containing protein 19 |
3swm_D | 5e-32 | 1 | 88 | 87 | 169 | NAC domain-containing protein 19 |
3swp_A | 5e-32 | 1 | 88 | 87 | 169 | NAC domain-containing protein 19 |
3swp_B | 5e-32 | 1 | 88 | 87 | 169 | NAC domain-containing protein 19 |
3swp_C | 5e-32 | 1 | 88 | 87 | 169 | NAC domain-containing protein 19 |
3swp_D | 5e-32 | 1 | 88 | 87 | 169 | NAC domain-containing protein 19 |
4dul_A | 5e-32 | 1 | 88 | 84 | 166 | NAC domain-containing protein 19 |
4dul_B | 5e-32 | 1 | 88 | 84 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.9859 | 0.0 | fruit| leaf| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF198127 | 0.0 | KF198127.1 Malus hupehensis NAC domain protein (NAC120) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008368238.2 | 1e-116 | NAC domain-containing protein 1-like | ||||
Swissprot | K4BNG7 | 2e-61 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
TrEMBL | D9ZJA9 | 1e-114 | D9ZJA9_MALDO; NAC domain class transcription factor | ||||
STRING | XP_008361781.1 | 1e-115 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4103 | 32 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 9e-62 | NAC-like, activated by AP3/PI |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000323779 |
Publications ? help Back to Top | |||
---|---|---|---|
|