PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000196986 | ||||||||
Common Name | MYB33 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 190aa MW: 20914.6 Da PI: 9.7763 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.7 | 1.5e-19 | 12 | 57 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd+ l ++v+++G+++W++I++ ++ gR++k+c++rw + MDP0000196986 12 KGPWSPEEDDSLQKLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 56.7 | 5.6e-18 | 66 | 108 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+eEd+ +++a++++G++ W+tIar ++ gRt++ +k++w++ MDP0000196986 66 AFTPEEDDTIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 108 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.661 | 7 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.47E-32 | 9 | 105 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-16 | 11 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-19 | 12 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-26 | 13 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.42E-16 | 14 | 56 | No hit | No description |
SMART | SM00717 | 9.2E-15 | 63 | 111 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.996 | 64 | 113 | IPR017930 | Myb domain |
CDD | cd00167 | 1.52E-12 | 66 | 109 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.4E-24 | 66 | 112 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 9.8E-16 | 66 | 108 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MAVIRKDMDR IKGPWSPEED DSLQKLVQKH GPRNWSLISK SIPGRSGKSC RLRWCNQLSP 60 QVEHRAFTPE EDDTIIRAHA RFGNKWATIA RLLNGRTDNA IKNHWNSTLK RKCSDVGGVV 120 LNGGYDGHYL LDHEQPPLKR SVSAGSGVPV STGLYMSPGS PSGSDVSDSS VQVMSLPDCH 180 VYRPVARSGG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 6e-42 | 11 | 113 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 6e-42 | 11 | 113 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.11356 | 0.0 | bud| fruit| leaf |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ074461 | 0.0 | DQ074461.1 Malus x domestica MYB6 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028963833.1 | 1e-139 | transcription factor MYB44-like isoform X1 | ||||
Swissprot | O23160 | 4e-93 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | A0A498KP94 | 1e-138 | A0A498KP94_MALDO; Uncharacterized protein | ||||
STRING | XP_008391509.1 | 1e-139 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF843 | 34 | 124 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37260.1 | 2e-85 | myb domain protein 73 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000196986 |
Publications ? help Back to Top | |||
---|---|---|---|
|