PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000126517 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 255aa MW: 28901.9 Da PI: 9.0628 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 163.6 | 7.3e-51 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 lppGfrFhPtdeelv +yL++k+ + +l++ ++i+evd++k++PwdLp e+e yfFs+r+ ky++g+r+nrat sgyWkatg dk++++ MDP0000126517 14 LPPGFRFHPTDEELVLQYLRRKAYSCPLPA-SIIPEVDVCKADPWDLPGD---CEQERYFFSTREAKYPNGNRSNRATCSGYWKATGLDKQIVTCr 105 79****************************.89***************44...46799*********************************98765 PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g++vg+kktLvfy+g+ p+g++tdW+mheyrl MDP0000126517 106 GGQVVGMKKTLVFYRGKPPHGTRTDWIMHEYRL 138 8999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.89E-61 | 10 | 173 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.37 | 14 | 173 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.9E-26 | 15 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 255 aa Download sequence Send to blast |
MERISFVKNG VLRLPPGFRF HPTDEELVLQ YLRRKAYSCP LPASIIPEVD VCKADPWDLP 60 GDCEQERYFF STREAKYPNG NRSNRATCSG YWKATGLDKQ IVTCRGGQVV GMKKTLVFYR 120 GKPPHGTRTD WIMHEYRLVL PENPASIAPP EKNSTQSPVV PMDNWVLCRI FLKKRGGKNE 180 EEQVQQPSFN VRKPKNLRPV FYDFMTKDRE NLSLAPCSSS SGSSGITDVV SSEQVDNDHG 240 ESSSCNSLGL IRRKQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-53 | 12 | 174 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-53 | 12 | 174 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-53 | 12 | 174 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-53 | 12 | 174 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
4dul_A | 5e-53 | 12 | 174 | 15 | 166 | NAC domain-containing protein 19 |
4dul_B | 5e-53 | 12 | 174 | 15 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.3963 | 0.0 | bud| fruit| leaf| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00507 | DAP | Transfer from AT5G13180 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008389924.1 | 0.0 | NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 2e-97 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A498I856 | 0.0 | A0A498I856_MALDO; Uncharacterized protein | ||||
STRING | XP_008389924.1 | 0.0 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF704 | 34 | 139 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 5e-99 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000126517 |
Publications ? help Back to Top | |||
---|---|---|---|
|