PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10025024 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 155aa MW: 17401.4 Da PI: 4.9014 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 38.2 | 3.1e-12 | 29 | 86 | 5 | 62 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 ++ +r+++NRe+ArrsR RK++++e L + +L++eN++ + ++e + + +++s Lus10025024 29 RKRKRMISNRESARRSRMRKQKQVEDLVSETSQLQKENEQIRRQVEVSGQRYVEMESA 86 67899*************************************9999887777777665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.0E-15 | 25 | 89 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 7.5E-11 | 26 | 74 | No hit | No description |
PROSITE profile | PS50217 | 11.174 | 27 | 74 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 8.7E-11 | 29 | 87 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.45E-11 | 29 | 83 | No hit | No description |
CDD | cd14702 | 2.84E-16 | 30 | 80 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 32 | 47 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MSGSASSQRQ PASSGSDTDP RYANVADERK RKRMISNRES ARRSRMRKQK QVEDLVSETS 60 QLQKENEQIR RQVEVSGQRY VEMESANNVL KAQAMELTDR LRSLNSVLEI VEAVSGLDVD 120 IPEMPDDRLF EPWVSVQQQP IMASVAAAGD TLEY* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 28 | 49 | RKRKRMISNRESARRSRMRKQK |
2 | 41 | 48 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122, ECO:0000269|PubMed:25108460}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10025024 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:21278122}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU830215 | 7e-33 | EU830215.1 Linum usitatissimum clone LU0009F03 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021280042.1 | 1e-62 | bZIP transcription factor 53 | ||||
Swissprot | Q9LZP8 | 8e-51 | BZP53_ARATH; bZIP transcription factor 53 | ||||
TrEMBL | A0A061DR45 | 2e-61 | A0A061DR45_THECC; Basic region/leucine zipper motif 53 | ||||
STRING | Lus10025024 | 1e-106 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4202 | 34 | 60 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62420.1 | 3e-53 | basic region/leucine zipper motif 53 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10025024 |
Publications ? help Back to Top | |||
---|---|---|---|
|