PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10007726 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 149aa MW: 17118.2 Da PI: 10.1105 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 35.3 | 2.5e-11 | 57 | 107 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 ++err+ +NRe+ArrsR RKk +e+L+e + L eN++Lk l + + Lus10007726 57 RKERRMKSNRESARRSRWRKKRHLEKLTEQANRLRMENQELKYMLGSTLSQ 107 79***************************************9777665555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 5.6E-9 | 53 | 102 | No hit | No description |
SMART | SM00338 | 1.2E-9 | 53 | 117 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.484 | 55 | 98 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.6E-9 | 57 | 109 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.38E-10 | 57 | 110 | No hit | No description |
CDD | cd14702 | 1.60E-15 | 58 | 109 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 60 | 75 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MFATEFDCPV HIEQGFTAHD LENLLSIFDS QTGGSPNSNS GSEGWSNRSV NYDVDERKER 60 RMKSNRESAR RSRWRKKRHL EKLTEQANRL RMENQELKYM LGSTLSQCHV VRRDNQRLRS 120 ESVALRGRLT HLCHALVAMH GHAVNNGL* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10007726 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021285085.1 | 2e-44 | basic leucine zipper 4 | ||||
Swissprot | Q9LQ65 | 1e-15 | BZIP4_ARATH; Basic leucine zipper 4 | ||||
TrEMBL | A0A1R3FYS1 | 5e-40 | A0A1R3FYS1_COCAP; Uncharacterized protein | ||||
STRING | Lus10007726 | 1e-106 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5996 | 30 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G59530.1 | 9e-18 | basic leucine-zipper 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10007726 |
Publications ? help Back to Top | |||
---|---|---|---|
|