PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj5g3v0296120.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 241aa MW: 25734.3 Da PI: 9.7093 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.1 | 4.8e-19 | 5 | 50 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+ +G+++W++I++ ++ gR++k+c++rw + Lj5g3v0296120.1 5 KGPWSPEEDEALTRLVQVHGPKNWTAISKSIP-GRSGKSCRLRWCNQ 50 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 54 | 3.9e-17 | 59 | 101 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+eEd +++a++++G++ W+tIar ++ gRt++ +k++w++ Lj5g3v0296120.1 59 PFTPEEDSAIIRAHARFGNK-WATIARILN-GRTDNAVKNHWNST 101 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 28.359 | 1 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.61E-32 | 2 | 98 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.5E-17 | 4 | 53 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-18 | 5 | 50 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-25 | 6 | 58 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.43E-17 | 7 | 49 | No hit | No description |
SMART | SM00717 | 6.7E-15 | 56 | 104 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.875 | 57 | 106 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.4E-14 | 59 | 101 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.5E-23 | 59 | 105 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.31E-13 | 59 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:2000022 | Biological Process | regulation of jasmonic acid mediated signaling pathway | ||||
GO:2000031 | Biological Process | regulation of salicylic acid mediated signaling pathway | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 241 aa Download sequence Send to blast |
MDRVKGPWSP EEDEALTRLV QVHGPKNWTA ISKSIPGRSG KSCRLRWCNQ LSPEVEHRPF 60 TPEEDSAIIR AHARFGNKWA TIARILNGRT DNAVKNHWNS TLKRKCSAVD TAVDHRPLKR 120 SASVGAGCLN PSSPTGSAMS DPGPPAAIST DAPIAVPAAV VVPATDPATS LSLSLPGFDS 180 SGSGSGSKQL FGAEFLAVMQ EMIRKEVRSY MSGMEEKNGA CMPAEAIGNA VMKRMGISNV 240 K |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 8e-41 | 4 | 106 | 3 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 4e-40 | 4 | 106 | 57 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 4e-40 | 4 | 106 | 57 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 6e-41 | 4 | 106 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 6e-41 | 4 | 106 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.16992 | 0.0 | root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00596 | DAP | Transfer from AT5G67300 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj5g3v0296120.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP006428 | 0.0 | AP006428.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT04J15, TM0321, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027940594.1 | 1e-122 | transcription factor MYB44-like | ||||
Swissprot | Q9FDW1 | 3e-82 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | A0A4D6MG62 | 1e-121 | A0A4D6MG62_VIGUN; Myb proto-oncogene protein | ||||
STRING | XP_007160886.1 | 1e-120 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF843 | 34 | 124 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 9e-74 | myb domain protein r1 |