PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj4g3v1646660.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 163aa MW: 19133.1 Da PI: 9.3014 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 183.4 | 5.5e-57 | 16 | 142 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrFhPtdeel+++yL kkv + ++++ ++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ Lj4g3v1646660.1 16 LPPGFRFHPTDEELISHYLYKKVIDIEFSA-RAIGEVDLNKCEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFR 108 79**************************99.89***************888999**************************************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129 +++lvg+kktLvfykgrapkgek++Wvmheyrle Lj4g3v1646660.1 109 -GKSLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 142 .999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.97E-62 | 12 | 153 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.66 | 16 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.9E-30 | 17 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MENISVLSKE EDQMDLPPGF RFHPTDEELI SHYLYKKVID IEFSARAIGE VDLNKCEPWD 60 LPWKAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIFRGK SLVGMKKTLV 120 FYKGRAPKGE KSNWVMHEYR LEGKFSVHNL PKTAKVIDCP VFF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 7e-53 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 7e-53 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 7e-53 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 7e-53 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swm_B | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swm_C | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swm_D | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swp_A | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swp_B | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swp_C | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swp_D | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
4dul_A | 7e-53 | 13 | 141 | 14 | 142 | NAC domain-containing protein 19 |
4dul_B | 7e-53 | 13 | 141 | 14 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj4g3v1646660.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT094159 | 1e-144 | BT094159.1 Soybean clone JCVI-FLGm-18C12 unknown mRNA. | |||
GenBank | EU661925 | 1e-144 | EU661925.1 Glycine max NAC domain protein (NAC28) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027331675.1 | 1e-108 | NAC domain-containing protein 100-like | ||||
Swissprot | Q9FLJ2 | 1e-100 | NC100_ARATH; NAC domain-containing protein 100 | ||||
TrEMBL | C6T9I7 | 1e-104 | C6T9I7_SOYBN; Uncharacterized protein (Fragment) | ||||
TrEMBL | R4N7I9 | 1e-104 | R4N7I9_JATCU; NAC transcription factor 002 | ||||
STRING | GLYMA17G10970.1 | 1e-105 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF409 | 34 | 171 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61430.1 | 1e-102 | NAC domain containing protein 100 |
Publications ? help Back to Top | |||
---|---|---|---|
|