PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0101s0274.21.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 269aa MW: 30384.9 Da PI: 8.448 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41.2 | 4e-13 | 23 | 68 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 WT+eEd++l + ++ +G++ +W+ +a+++ +t qc+ rw++yl Kaladp0101s0274.21.p 23 VWTQEEDDILREQIRIYGTDnSWAIVASEFS-DKTTRQCRRRWYTYL 68 6******************************.*************97 PP | |||||||
2 | Myb_DNA-binding | 45.5 | 1.8e-14 | 74 | 117 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g WT+eEd ll + +++G++ W+ Ia+++ gRt++ +k+r+ + Kaladp0101s0274.21.p 74 KGGWTPEEDALLCESQRKYGNK-WTEIAKMVS-GRTDNAVKNRFST 117 688*******************.*********.**********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.356 | 16 | 68 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-12 | 20 | 70 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-19 | 24 | 76 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.78E-11 | 24 | 68 | No hit | No description |
Pfam | PF13921 | 2.5E-15 | 24 | 85 | No hit | No description |
SuperFamily | SSF46689 | 2.55E-26 | 48 | 129 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.651 | 69 | 123 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-14 | 73 | 121 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.31E-10 | 77 | 118 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.8E-21 | 77 | 122 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 269 aa Download sequence Send to blast |
MKKRSDSNST EGANKLKERH IVVWTQEEDD ILREQIRIYG TDNSWAIVAS EFSDKTTRQC 60 RRRWYTYLNS DFKKGGWTPE EDALLCESQR KYGNKWTEIA KMVSGRTDNA VKNRFSTLCK 120 KKAKREALAE EDSTSLSSVG KKRAWLKNQP HKTGTEENQV PYKKIRRIRI SVPAESCNRG 180 KLIPGDYPLG EHTQIIPDLC EESSGSSDYS TGSTLLSHVT EGTPTNQTMD ISELNQDSGS 240 EIRISLGQKE SEESMTIFGS LSYQGKLI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-26 | 24 | 123 | 10 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB88, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:11536724, PubMed:9684356, PubMed:16155180, PubMed:24123248). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Also involved in the shape regulation of pavement cells (PubMed:9684356). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Promotes histone H3K27me3 marks and represses stem cell gene expression (PubMed:24654956). Required for lateral roots (LRs) initiation via the regulation of PIN3 expression in an auxin-dependent manner (PubMed:26578065). Involved in responses to gravity stimulation in primary roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells, thus modulating auxin asymmetric redistribution (PubMed:26578169). {ECO:0000269|PubMed:11536724, ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169, ECO:0000269|PubMed:9684356}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Strongly induced by auxin in a IAA14/SLR1 and ARF7 dependent manner, especially in xylem pole pericycle cells, lateral roots initiating cells. {ECO:0000269|PubMed:26578065}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028085660.1 | 8e-79 | transcription factor MYB124-like | ||||
Swissprot | Q94FL6 | 1e-62 | MY124_ARATH; Transcription factor MYB124 | ||||
TrEMBL | A0A2G9GFM6 | 8e-76 | A0A2G9GFM6_9LAMI; Transcription factor, Myb superfamily | ||||
STRING | XP_008221735.1 | 5e-74 | (Prunus mume) | ||||
STRING | VIT_01s0026g01910.t01 | 6e-74 | (Vitis vinifera) | ||||
STRING | XP_009778520.1 | 4e-74 | (Nicotiana sylvestris) | ||||
STRING | PGSC0003DMT400065797 | 3e-74 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14350.2 | 9e-59 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0101s0274.21.p |