 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G14350.2 | ||||||||
| Common Name | AtMYB124, FLP, MYB124 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 436aa MW: 49599.6 Da PI: 6.8758 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 43.2 | 9.3e-14 | 27 | 71 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
W++eEd +l + ++++G+++W+ Ia+++ ++ qc+ rw++yl
AT1G14350.2 27 TWSQEEDVILREQITLHGTENWAIIASKFK-DKSTRQCRRRWYTYL 71
6****************************9.*************97 PP
| |||||||
| 2 | Myb_DNA-binding | 42.8 | 1.2e-13 | 77 | 120 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
rg W++eEd ll +a + +G++ W+ Ia+ + gRt++ +k+r+ +
AT1G14350.2 77 RGGWSPEEDMLLCEAQRVFGNR-WTEIAKVVS-GRTDNAVKNRFTT 120
789*******************.*********.**********976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 2.79E-10 | 14 | 68 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 15.253 | 20 | 71 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.1E-12 | 24 | 73 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.41E-11 | 27 | 71 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-19 | 28 | 78 | IPR009057 | Homeodomain-like |
| Pfam | PF13921 | 1.3E-14 | 28 | 88 | No hit | No description |
| SuperFamily | SSF46689 | 1.2E-24 | 50 | 132 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 19.923 | 72 | 126 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.0E-14 | 76 | 124 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-19 | 79 | 125 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.78E-10 | 80 | 121 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
| GO:0009553 | Biological Process | embryo sac development | ||||
| GO:0010052 | Biological Process | guard cell differentiation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
| GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0000351 | anatomy | guard mother cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 436 aa Download sequence Send to blast |
MEDTKKKKKK NINNNQDSKK KERHIVTWSQ EEDVILREQI TLHGTENWAI IASKFKDKST 60 RQCRRRWYTY LNSDFKRGGW SPEEDMLLCE AQRVFGNRWT EIAKVVSGRT DNAVKNRFTT 120 LCKKRAKHEA MTKDSNSNTK RMLFLDGIST PRKSENETPI AKKLKRSHIL DLTEISNYGR 180 AEACVNQQIR SPFSVLARNA TGIDSLEEQN QTSNVNESDG EGMFLKKDDP KVTALMQQAE 240 LLSSLAQKVN ADNTEQSMEN AWKVLQDFLN KGKENDLFRY GIPDIDFKIE EFKDLIEDLR 300 SGYEDNQLSW RQPDLHDSPA SSEYSSGSTI MVDQSGDKTQ PFSADTQTEH KQVGEELLVP 360 KNPDENMPIS GEEKFSSPIQ VTPLFRSLAD GIPSPQFSES ERSFLLKTLG IESSSPCPSA 420 NPSKPPPCKR VLLHSL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 7e-26 | 28 | 126 | 10 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.12041 | 0.0 | bud| flower| root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 261491_at | 0.0 | ||||
| Expression Atlas | AT1G14350 | - | ||||
| AtGenExpress | AT1G14350 | - | ||||
| ATTED-II | AT1G14350 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed at the transition to terminal stomatal differentiation, just before and after the symmetric division of stomatal differentiation, being confined to late-stage guard mother cells (GMC) and to young, still differentiating guard cells (PubMed:16155180, PubMed:24571519). Detected in unopened flower buds, at the bases of sepals, petals, and stamens and in the receptacle of carpels, as well as both in style and stigma. Present at strong levels in the placenta within the ovary. Accumulates during ovule development in a dynamic pattern; first observed at high levels in the funiculus once integument outgrowth has begun and persists into later stages. Also expressed in the nucellus of younger ovules, especially in the megaspore mother cell (MMC) and in epidermal cells. Present in integuments, in the endothelial layer and the outer layer of the outer integument, which will form the mucilage-containing seed coat cells (PubMed:22915737). In developing embryos, first detected in cells in the ground tissue meristem at the early heart stage accumulates in the torpedo stage. In mature embryos, expressed in the embryonic hypocotyl and root tip. In seedlings, present first in the lower part of the hypocotyl and in the root tip, and later in petioles of cotyledons, young leaves, and lateral root primordia, near the pericycle. In young plants, strongly expressed in petioles of young leaves and cotyledons, especially in veins, in the basal part of young first leaves and cotyledons, and in root tips of lateral roots. Detected in the phloem, as well as in the cortex of inflorescence stems (PubMed:26391711). In roots, present in the root tip in columella cells, specifically in the lower tier of columella cells, as well as in developing metaxylem (PubMed:26391711, PubMed:26578169). Widely expressed in freshly emerged lateral roots. In elongating lateral roots, confined at high levels transiently in columella cells until differentiation (PubMed:26578169). Expressed at the base of developing flowers, including ovaries. In flowers, detected in ovaries, receptacles, and transiently, in anthers, and, later, in filaments. Also detected in the valve margins and receptacles of siliques and at the joint between the stigma and the style, as well as in the tapetum around pollen grains in maturing anthers (PubMed:26391711). {ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:26391711, ECO:0000269|PubMed:26578169}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in all shoot organs with higher levels in leaves, stems, flowers, siliques and floral buds. Also detected in roots tips. {ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:26391711}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a putative MYB transcription factor involved in stomata development, loss of FLP activity results in a failure of guard mother cells (GMCs) to adopt the guard cell fate, thus they continue to divide resulting in abnormal stomata consisting of clusters of numerous guard cell-like cells. This phenotype is enhanced in double mutants with MYB88. | |||||
| UniProt | Transcription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB88, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:11536724, PubMed:9684356, PubMed:16155180, PubMed:24123248). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Also involved in the shape regulation of pavement cells (PubMed:9684356). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Promotes histone H3K27me3 marks and represses stem cell gene expression (PubMed:24654956). Required for lateral roots (LRs) initiation via the regulation of PIN3 expression in an auxin-dependent manner (PubMed:26578065). Involved in responses to gravity stimulation in primary roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells, thus modulating auxin asymmetric redistribution (PubMed:26578169). {ECO:0000269|PubMed:11536724, ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169, ECO:0000269|PubMed:9684356}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G14350.2 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Strongly induced by auxin in a IAA14/SLR1 and ARF7 dependent manner, especially in xylem pole pericycle cells, lateral roots initiating cells. {ECO:0000269|PubMed:26578065}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Target Gene (A: Activate/R: Repress) | |||||
| ATRM | AT3G54180(R), AT4G34160(A) | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G14350 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF371982 | 0.0 | AF371982.2 Arabidopsis thaliana putative transcription factor MYB124 (MYB124) mRNA, complete cds. | |||
| GenBank | BT026126 | 0.0 | BT026126.1 Arabidopsis thaliana. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001077534.1 | 0.0 | Duplicated homeodomain-like superfamily protein | ||||
| Refseq | NP_563948.1 | 0.0 | Duplicated homeodomain-like superfamily protein | ||||
| Swissprot | Q94FL6 | 0.0 | MY124_ARATH; Transcription factor MYB124 | ||||
| TrEMBL | A0A178W3Z3 | 0.0 | A0A178W3Z3_ARATH; MYB124 | ||||
| STRING | AT1G14350.2 | 0.0 | (Arabidopsis thaliana) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G14350.2 |
| Entrez Gene | 837997 |
| iHOP | AT1G14350 |
| wikigenes | AT1G14350 |
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|