PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV44471.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 144aa MW: 16091.2 Da PI: 10.5449 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 173.2 | 1.7e-53 | 1 | 133 | 24 | 170 |
YABBY 24 vsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPekr 122 v+vP +s+f++vtvrCGhC++llsvn+ q l ++ + +k++++++ ++ s+s+s++ + ++ p+ p irPPekr KZV44471.1 1 VNVPCSSSFNIVTVRCGHCANLLSVNVGALLQSLHLQDF----------QIQKQHSSHFGG---VKDIGSSSRSNMFAAFQAEQVQPKSTP-IRPPEKR 85 89**************************99988877774..........223334444433...333333333333334556677777777.9****** PP YABBY 123 qrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 qrvPsaynrfikeeiqrikasnP+ishreafs+aaknWahfP+ihfgl KZV44471.1 86 QRVPSAYNRFIKEEIQRIKASNPEISHREAFSTAAKNWAHFPHIHFGL 133 **********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 8.6E-58 | 1 | 133 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.11E-8 | 74 | 126 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 2.7E-5 | 80 | 127 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0010158 | Biological Process | abaxial cell fate specification |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
VNVPCSSSFN IVTVRCGHCA NLLSVNVGAL LQSLHLQDFQ IQKQHSSHFG GVKDIGSSSR 60 SNMFAAFQAE QVQPKSTPIR PPEKRQRVPS AYNRFIKEEI QRIKASNPEI SHREAFSTAA 120 KNWAHFPHIH FGLKLETNSK QATN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV44471.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011088989.1 | 1e-74 | putative axial regulator YABBY 2 isoform X1 | ||||
Refseq | XP_011088990.1 | 1e-74 | putative axial regulator YABBY 2 isoform X1 | ||||
Swissprot | Q9XFB0 | 3e-59 | YAB2_ARATH; Putative axial regulator YABBY 2 | ||||
TrEMBL | A0A2Z7CBP8 | 1e-102 | A0A2Z7CBP8_9LAMI; Axial regulator YABBY 2 (Fragment) | ||||
STRING | VIT_06s0009g00880.t01 | 6e-69 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA381 | 24 | 163 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 1e-61 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|