PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN21942.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 81aa MW: 9757.2 Da PI: 8.7457 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 64.3 | 2.5e-20 | 2 | 78 | 296 | 373 |
GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 n +aceg+er+er et+++W+ r ++aGFk++pl+e+ +++ ++ l++++ d + ++e+++++++gWk+r + ++W KHN21942.1 2 NFIACEGSERIERPETYKQWQVRNMKAGFKQLPLDEELMAKFRSKLKEYHRD-FVLDENNNWMLQGWKGRIFNASTCW 78 99************************************************66.************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 13.65 | 1 | 60 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 8.8E-18 | 2 | 78 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
MNFIACEGSE RIERPETYKQ WQVRNMKAGF KQLPLDEELM AKFRSKLKEY HRDFVLDENN 60 NWMLQGWKGR IFNASTCWVP A |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN21942.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014619523.1 | 1e-48 | scarecrow-like protein 31 | ||||
Refseq | XP_025980192.1 | 1e-48 | scarecrow-like protein 31 | ||||
Refseq | XP_028187655.1 | 1e-48 | scarecrow-like protein 31 | ||||
Refseq | XP_028187656.1 | 1e-48 | scarecrow-like protein 31 | ||||
Refseq | XP_028192342.1 | 2e-48 | scarecrow-like protein 14 | ||||
Swissprot | Q3EDH0 | 2e-34 | SCL31_ARATH; Scarecrow-like protein 31 | ||||
TrEMBL | A0A445HLP2 | 5e-47 | A0A445HLP2_GLYSO; Scarecrow-like protein 14 isoform A | ||||
TrEMBL | I1LK07 | 3e-47 | I1LK07_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA11G14700.1 | 5e-48 | (Glycine max) | ||||
STRING | GLYMA12G06655.1 | 9e-48 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14801 | 8 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07520.1 | 8e-37 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|