PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN17172.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 144aa MW: 17122.6 Da PI: 10.5898 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 30.7 | 6.7e-10 | 59 | 103 | 5 | 49 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 ++ rr+q+NRe+ArrsR RKk +e+L + L eN++++++l KHN17172.1 59 RKLRRMQSNRESARRSRWRKKRHLENLMNQLNRLRMENQKYRNRL 103 5789*************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 7.8E-9 | 55 | 119 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.91 | 57 | 103 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.7E-7 | 59 | 110 | No hit | No description |
SuperFamily | SSF57959 | 1.04E-9 | 59 | 113 | No hit | No description |
Pfam | PF00170 | 1.4E-7 | 59 | 103 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 9.94E-13 | 60 | 109 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 62 | 77 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000165 | Biological Process | MAPK cascade | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005622 | Cellular Component | intracellular | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0004707 | Molecular Function | MAP kinase activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MFFHEEAEAV QSSYFPVLET MFTPSEIEEL FSLVNEPASP GLGSGSQGSN REVRSMHERK 60 LRRMQSNRES ARRSRWRKKR HLENLMNQLN RLRMENQKYR NRLFLTMHQN LLLSLENERL 120 RSESMTLMAR LSDLYQILGT MISQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN17172.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028208505.1 | 2e-91 | basic leucine zipper 4 | ||||
TrEMBL | A0A445GAU0 | 4e-90 | A0A445GAU0_GLYSO; BZIP transcription factor 44 | ||||
STRING | GLYMA14G10020.1 | 1e-86 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5996 | 30 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49760.1 | 4e-17 | basic leucine-zipper 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|