PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.11G045900.1.p | ||||||||
Common Name | GLYMA_11G045900, LOC102661188 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 171aa MW: 19848.7 Da PI: 11.2428 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 37.4 | 5.5e-12 | 71 | 130 | 5 | 64 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 ++ rr+++NRe+ArrsR RK+ +e+L++ + + eN++L + l+ l ++ +l++e+e Glyma.11G045900.1.p 71 RKRRRMISNRESARRSRIRKQRHLENLRNQMNLFRVENRKLNNGLQFLLHHCNRLRTENE 130 6789***************************************************99985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 8.6E-9 | 62 | 126 | No hit | No description |
SMART | SM00338 | 9.5E-12 | 67 | 131 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.3 | 69 | 132 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.9E-10 | 71 | 130 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.31E-10 | 71 | 123 | No hit | No description |
CDD | cd14702 | 5.83E-16 | 72 | 123 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 74 | 89 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MLSALPFQGN PFPALDYAFM PWDGLDSLGF KPTSPNPVTS SSGSGYPNRT HAEEKPASDK 60 SNHVTSVMEE RKRRRMISNR ESARRSRIRK QRHLENLRNQ MNLFRVENRK LNNGLQFLLH 120 HCNRLRTENE WLLSERPMLR QKLANINQIL LFRHLQPFSS AWPCNIVLAE * |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 70 | 74 | RKRRR |
2 | 83 | 90 | RRSRIRKQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.11G045900.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006590620.1 | 1e-123 | bZIP transcription factor 53 | ||||
Refseq | XP_028189273.1 | 1e-123 | bZIP transcription factor 53-like | ||||
TrEMBL | A0A0B2PUK9 | 1e-122 | A0A0B2PUK9_GLYSO; BZIP transcription factor 2 | ||||
TrEMBL | K7LN23 | 1e-122 | K7LN23_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA11G04920.2 | 1e-123 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5435 | 32 | 54 | Representative plant | OGRP8744 | 8 | 15 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49760.1 | 3e-30 | basic leucine-zipper 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.11G045900.1.p |
Entrez Gene | 102661188 |