PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00133732001 | ||||||||
Common Name | GSBRNA2T00133732001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 148aa MW: 16844 Da PI: 10.9087 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 42.5 | 8.8e-14 | 57 | 87 | 5 | 35 |
GATA 5 gttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 +ttkTp+WR gp+ +k+LCnaCG++ rk+++ GSBRNA2T00133732001 57 KTTKTPMWRGGPSCPKSLCNACGIRLRKQRR 87 79**************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 3.94E-9 | 46 | 87 | No hit | No description |
SMART | SM00401 | 7.8E-11 | 47 | 103 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 9.17 | 47 | 83 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 1.1E-10 | 51 | 87 | IPR013088 | Zinc finger, NHR/GATA-type |
Pfam | PF00320 | 1.1E-11 | 57 | 87 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MYDIKKKEGL YMTKSKRRKQ PCHSFSIVLG VLWYSKGALI TKMEEEKKTV RCCSERKTTK 60 TPMWRGGPSC PKSLCNACGI RLRKQRRSEL LGIRIIHSHK AYKKINPSPS SLSFSHGGVF 120 LKKRRILKEE EQAALCLLLL SRNSAFA* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 4 | 18 | KKKEGLYMTKSKRRK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00133732001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013597259.1 | 7e-71 | PREDICTED: GATA transcription factor 23-like | ||||
Swissprot | Q8LC59 | 8e-39 | GAT23_ARATH; GATA transcription factor 23 | ||||
TrEMBL | A0A3P5YXM2 | 1e-69 | A0A3P5YXM2_BRACM; Uncharacterized protein | ||||
STRING | XP_006394919.1 | 4e-47 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14484 | 16 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 6e-37 | GATA transcription factor 23 |
Publications ? help Back to Top | |||
---|---|---|---|
|