PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00090660001
Common NameGSBRNA2T00090660001, LOC106445053
Organism
Brassica napus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bHLH
Protein Properties Length: 96aa    MW: 10834 Da    PI: 8.5168
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00090660001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH25.42.5e-0821611454
                         HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                  HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                         d+i +   +L+ l+P++ + +s K+s +++L+++++YI++L
  GSBRNA2T00090660001 21 DQISDLVTRLQHLIPELRRRRSDKVSASTVLQETCNYIRNL 61
                         68999999********889********************99 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.652761IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.0E-92175IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.09E-92179IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000107.6E-62161IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MSSRRSSRSR QSSGSSRISD DQISDLVTRL QHLIPELRRR RSDKVSASTV LQETCNYIRN  60
LHREVDDLSD RLSELLATTD DNSAEAAIIR SLLNY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12840RLQHLIPELRRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.239821e-163vegetative meristem
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269|PubMed:16786307, ECO:0000269|PubMed:23224238}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00090660001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269|PubMed:16786307}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1191101e-111AK119110.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL21-46-D20.
GenBankBT0046861e-111BT004686.1 Arabidopsis thaliana At1g26948 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115425.12e-59PREDICTED: transcription factor PRE6-like
RefseqXP_013741990.12e-59transcription factor PRE6
SwissprotQ8GW321e-45PRE6_ARATH; Transcription factor PRE6
TrEMBLA0A078FTM94e-58A0A078FTM9_BRANA; BnaA09g29410D protein
TrEMBLA0A397XYQ74e-58A0A397XYQ7_BRACM; Uncharacterized protein
TrEMBLM4E7B74e-58M4E7B7_BRARP; Uncharacterized protein
STRINGBra024672.1-P7e-59(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25928225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.15e-44bHLH family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Gommers CM, et al.
    Molecular Profiles of Contrasting Shade Response Strategies in Wild Plants: Differential Control of Immunity and Shoot Elongation.
    Plant Cell, 2017. 29(2): p. 331-344
    [PMID:28138015]
  4. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  5. Zheng K, et al.
    Involvement of PACLOBUTRAZOL RESISTANCE6/KIDARI, an Atypical bHLH Transcription Factor, in Auxin Responses in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1813
    [PMID:29114256]