PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00047230001 | ||||||||
Common Name | GSBRNA2T00047230001, LOC106360280 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 159aa MW: 17927.2 Da PI: 10.5495 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 193.5 | 9.6e-60 | 1 | 134 | 31 | 170 |
YABBY 31 lfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPe 120 +f++vtvrCGhCt+lls+n+ ++ ++ + + +++l++++++ +++++ ++ ++s s+++ s++lsen d+e+pr+pp irPPe GSBRNA2T00047230001 1 MFTLVTVRCGHCTNLLSLNIGVSLHQSPPTPI-----HQDLQQHKQQITTSITRKEYGSSSRSSNHFSTTLSENVDREAPRMPP-IRPPE 84 699********************999998873.....4455555555556666666666666666666678***********99.9**** PP YABBY 121 krqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 krqrvPsaynrfikeeiqrika+nP+ishreafs+aaknWahfP+ihfgl GSBRNA2T00047230001 85 KRQRVPSAYNRFIKEEIQRIKAGNPEISHREAFSTAAKNWAHFPHIHFGL 134 ************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 8.2E-56 | 1 | 134 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 7.99E-8 | 79 | 127 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 8.8E-5 | 82 | 128 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MFTLVTVRCG HCTNLLSLNI GVSLHQSPPT PIHQDLQQHK QQITTSITRK EYGSSSRSSN 60 HFSTTLSENV DREAPRMPPI RPPEKRQRVP SAYNRFIKEE IQRIKAGNPE ISHREAFSTA 120 AKNWAHFPHI HFGLKLDGNK KGKQLDQTVA GQKSNGYY* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269|PubMed:10457020}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269|PubMed:10457020}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00047230001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353326 | 0.0 | AK353326.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-29-D23. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009110891.1 | 1e-116 | PREDICTED: putative axial regulator YABBY 2 isoform X1 | ||||
Refseq | XP_013655318.1 | 1e-116 | putative axial regulator YABBY 2 isoform X1 | ||||
Refseq | XP_013657611.1 | 1e-116 | putative axial regulator YABBY 2 isoform X1 | ||||
Swissprot | Q9XFB0 | 2e-97 | YAB2_ARATH; Putative axial regulator YABBY 2 | ||||
TrEMBL | A0A078H0Y7 | 1e-115 | A0A078H0Y7_BRANA; BnaA08g26920D protein | ||||
TrEMBL | A0A397YFU6 | 1e-115 | A0A397YFU6_BRACM; Uncharacterized protein | ||||
STRING | Bra030728.1-P | 1e-109 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5581 | 27 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 4e-93 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106360280 |
Publications ? help Back to Top | |||
---|---|---|---|
|