PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00034316001 | ||||||||
Common Name | GSBRNA2T00034316001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 164aa MW: 19087.8 Da PI: 9.3142 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 168.9 | 1.6e-52 | 16 | 145 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatg 87 +ppGfrFhPt+eel+++yL+kkv++ k++l +vi++vd++k+ePwd+++ k+ + +++wyfFs++dkky+tg+r+nrat+ g+Wkatg GSBRNA2T00034316001 16 VPPGFRFHPTEEELLQYYLRKKVNSIKIDL-DVIRDVDLNKLEPWDIQEmcKIGTtPQNDWYFFSHKDKKYPTGTRTNRATTVGFWKATG 104 69****************************.9***************962433332455******************************* PP NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 +dk ++s +g+ +g++ktLvfykgrap+g+k+dW+mheyrle GSBRNA2T00034316001 105 RDKIIYS-NGRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRLE 145 *******.999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.58E-56 | 10 | 149 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.347 | 16 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-28 | 17 | 144 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MMSESMSISV NGQSQVPPGF RFHPTEEELL QYYLRKKVNS IKIDLDVIRD VDLNKLEPWD 60 IQEMCKIGTT PQNDWYFFSH KDKKYPTGTR TNRATTVGFW KATGRDKIIY SNGRRIGMRK 120 TLVFYKGRAP HGQKSDWIMH EYRLEDKVIS PEDVTVHEVC IIS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-47 | 10 | 144 | 9 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in various aboveground tissues undergoing thickening of the lignified secondary wall such as anthers, filaments of stamens, the base of carpels, styles, the boundaries between siliques and pedicels, the midrib of leaf veins, and inflorescence stems, specifically in interfascicular fibers (sclerenchyma), cells differentiating into vascular vessels, and xylary fibers (secondary xylem). {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00034316001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT002931 | 0.0 | BT002931.1 Arabidopsis thaliana clone RAFL15-02-N12 (R20259) putative NAM (no apical meristem) protein (At2g46770) mRNA, complete cds. | |||
GenBank | BT020413 | 0.0 | BT020413.1 Arabidopsis thaliana At2g46770 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009142445.1 | 1e-117 | PREDICTED: NAC domain-containing protein 43-like | ||||
Swissprot | Q84WP6 | 1e-113 | NAC43_ARATH; NAC domain-containing protein 43 | ||||
TrEMBL | A0A078K4H5 | 1e-119 | A0A078K4H5_BRANA; BnaAnng41940D protein | ||||
STRING | Bra040486.1-P | 1e-116 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM778 | 28 | 124 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46770.1 | 1e-116 | NAC family protein |