PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00004862001

Common Name

GSBRNA2T00072914001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NAC

Protein Properties

Length: 165aa MW: 19055.7 Da PI: 10.2476

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00004862001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	168.2	2.6e-52	13	140	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +++yk+ePwdLp + k+k+++ ewyfFs d+ky++g+++nrat+ gyWk+tgk GSBRNA2T00004862001 13 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVTHVYKSEPWDLPsQsKLKSRDLEWYFFSVLDNKYSNGSKTNRATEMGYWKTTGK 101 579************************9.99**********95247777888**************************** PP NAM 89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 d+e+ + ++++vg+kktLv++kgrap+ge+++Wvmheyrl GSBRNA2T00004862001 102 DREIRN-GSRVVGMKKTLVYHKGRAPRGERSNWVMHEYRL 140 *9.9****************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.22E-59	10	160	IPR003441	NAC domain
PROSITE profile	PS51005	55.984	13	160	IPR003441	NAC domain
Pfam	PF02365	2.3E-28	15	140	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 165 aa Download sequence Send to blast
MGRRGGSSET SSLAPGFRFH PTDEELVRYY LKRKICNKPF KFDAISVTHV YKSEPWDLPS 60 QSKLKSRDLE WYFFSVLDNK YSNGSKTNRA TEMGYWKTTG KDREIRNGSR VVGMKKTLVY 120 HKGRAPRGER SNWVMHEYRL VDDDIVKAGD AYVLCKIFQK SGSGP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-44	12	164	16	169	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-44	12	164	16	169	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-44	12	164	16	169	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-44	12	164	16	169	NO APICAL MERISTEM PROTEIN
3swm_A	2e-44	12	164	19	172	NAC domain-containing protein 19
3swm_B	2e-44	12	164	19	172	NAC domain-containing protein 19
3swm_C	2e-44	12	164	19	172	NAC domain-containing protein 19
3swm_D	2e-44	12	164	19	172	NAC domain-containing protein 19
3swp_A	2e-44	12	164	19	172	NAC domain-containing protein 19
3swp_B	2e-44	12	164	19	172	NAC domain-containing protein 19
3swp_C	2e-44	12	164	19	172	NAC domain-containing protein 19
3swp_D	2e-44	12	164	19	172	NAC domain-containing protein 19
3ulx_A	2e-44	1	160	3	168	Stress-induced transcription factor NAC1
4dul_A	1e-44	12	164	16	169	NAC domain-containing protein 19
4dul_B	1e-44	12	164	16	169	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.11615	1e-162	seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in root meristem (Ref.1). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269\|PubMed:17158162, ECO:0000269\|Ref.1}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250\|UniProtKB:Q949N0, ECO:0000269\|PubMed:19887540, ECO:0000269\|PubMed:21889048}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00004862001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269\|PubMed:17158162, ECO:0000269\|PubMed:19887540}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013676533.1	1e-116	NAC domain-containing protein 53-like
Swissprot	Q84K00	2e-98	NAC78_ARATH; NAC domain-containing protein 78
TrEMBL	A0A078HVH3	1e-115	A0A078HVH3_BRANA; BnaA01g31650D protein
TrEMBL	A0A078JY85	1e-120	A0A078JY85_BRANA; BnaAnng34420D protein (Fragment)
STRING	Bo1g143830.1	1e-114	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1780	28	80

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G04410.1	1e-101	NAC domain containing protein 2

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Liang M, et al. Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana. Traffic, 2015. 16(10): p. 1062-74 [PMID:26201836] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Gladman NP,Marshall RS,Lee KH,Vierstra RD The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis. Plant Cell, 2016. 28(6): p. 1279-96 [PMID:27194708] Tang Y,Zhao CY,Tan ST,Xue HW Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078. PLoS Genet., 2016. 12(8): p. e1006252 [PMID:27529511]