PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.F00420.1.p | ||||||||
Common Name | EUGRSUZ_F00420, LOC104448025 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 226aa MW: 25355.9 Da PI: 6.066 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.8 | 6e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA ELSvLCdaevav+ifs tgkl+eyss Eucgr.F00420.1.p 9 KKIDNVTARQVTFSKRRRGLFKKAGELSVLCDAEVAVVIFSATGKLFEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 42.4 | 2.9e-15 | 89 | 170 | 17 | 98 |
K-box 17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + + +L ke+ + + +R+l GedL+ L+++eLqqLe+ Le +l+++ +K+e ++++i +l k el eenk+L++ + Eucgr.F00420.1.p 89 EHSNNMRLSKEVAEKSHRLRQLRGEDLQGLNIEELQQLEKMLEAGLNRVLVTKEERIRTEITDLETKGAELIEENKMLKQTM 170 4444456777777777889***********************************************************9975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.688 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.32E-40 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 3.27E-31 | 3 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.798 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 8.3E-14 | 92 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MAREKIKIKK IDNVTARQVT FSKRRRGLFK KAGELSVLCD AEVAVVIFSA TGKLFEYSSS 60 SMKDTLERYT LHHNNLENMD QPSLELQLEH SNNMRLSKEV AEKSHRLRQL RGEDLQGLNI 120 EELQQLEKML EAGLNRVLVT KEERIRTEIT DLETKGAELI EENKMLKQTM TTLTKGKRHI 180 VTEPDVALPE EGVSSESATN VCSCNSGPPL EDDGSDTSLK LGLPF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-20 | 1 | 73 | 1 | 73 | MEF2C |
5f28_B | 4e-20 | 1 | 73 | 1 | 73 | MEF2C |
5f28_C | 4e-20 | 1 | 73 | 1 | 73 | MEF2C |
5f28_D | 4e-20 | 1 | 73 | 1 | 73 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.F00420.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010060099.1 | 1e-164 | PREDICTED: MADS-box protein SVP isoform X2 | ||||
Swissprot | Q9FUY6 | 3e-92 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
Swissprot | Q9FVC1 | 2e-92 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A059BL70 | 1e-163 | A0A059BL70_EUCGR; Uncharacterized protein | ||||
STRING | XP_010060098.1 | 1e-161 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4190 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-89 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.F00420.1.p |
Entrez Gene | 104448025 |