PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_024249 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 241aa MW: 27440 Da PI: 6.3657 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.1 | 6.2e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd++l +++q G +W++ ++ g+ R++k+c++rw +yl DCAR_024249 14 KGPWTREEDQRLTSYIQQNGHSNWRALPKLSGLLRCGKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 47.3 | 4.9e-15 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++++eE+e ++++++ +G++ W++ a++++ gRt++++k+ w+++ DCAR_024249 67 RGNFSKEEEETIIQLHESMGNR-WSAMAAKLP-GRTDNEIKNVWHTH 111 89********************.*********.***********987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.345 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.07E-28 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.1E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-23 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.73E-8 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 23.562 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-13 | 67 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-26 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.43E-9 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 241 aa Download sequence Send to blast |
MVRAPCCDKI GLKKGPWTRE EDQRLTSYIQ QNGHSNWRAL PKLSGLLRCG KSCRLRWTNY 60 LNPDIKRGNF SKEEEETIIQ LHESMGNRWS AMAAKLPGRT DNEIKNVWHT HIKKKLKDYN 120 STQDIKRPKN KSEPQSKKPD SSTSKEIESL GHGSISPKSS TSELSSVTTD PDIIQQEVLI 180 SSTTVLLSEF GESICLTDIP DDQDMKVWLE IDEGFKCLKG DDDMSFWYNL FLTAEELPEF 240 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 3e-29 | 12 | 116 | 2 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 4e-29 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
1mse_C | 3e-29 | 12 | 116 | 2 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 3e-29 | 12 | 116 | 2 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017217072.1 | 1e-179 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q9LTC4 | 1e-70 | MYB15_ARATH; Transcription factor MYB15 | ||||
TrEMBL | A0A164T6A8 | 1e-177 | A0A164T6A8_DAUCS; Uncharacterized protein | ||||
STRING | XP_009601374.1 | 1e-86 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 5e-73 | myb domain protein 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_024249 |