PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_021802 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 116aa MW: 13536.2 Da PI: 9.9 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.1 | 6.5e-32 | 36 | 94 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +pr+YY+Ct++gC+vkk+v+r ++d+++v++tYeg H+h+ DCAR_021802 36 LDDGYRWRKYGQKTVKNNAHPRNYYKCTYQGCSVKKQVQRLDKDETIVVTTYEGIHTHS 94 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.5E-34 | 21 | 94 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.57E-29 | 28 | 95 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.943 | 31 | 96 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.9E-37 | 36 | 95 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.0E-26 | 37 | 93 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
MGTDDRNDEV KVDAKQKNKN KKQRFAFQTK SQVDILDDGY RWRKYGQKTV KNNAHPRNYY 60 KCTYQGCSVK KQVQRLDKDE TIVVTTYEGI HTHSIQKPSD DFQNILSEMK IFPTS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-28 | 26 | 95 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 3e-28 | 26 | 95 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017257414.1 | 7e-82 | PREDICTED: probable WRKY transcription factor 45 | ||||
Swissprot | Q9S763 | 1e-45 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
TrEMBL | A0A161XDQ7 | 2e-80 | A0A161XDQ7_DAUCS; Uncharacterized protein | ||||
STRING | Solyc02g094270.1.1 | 2e-51 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2204 | 24 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01970.1 | 9e-48 | WRKY DNA-binding protein 45 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_021802 |
Publications ? help Back to Top | |||
---|---|---|---|
|