PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.395470.1

Common Name

Csa_2G354050

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

bZIP

Protein Properties

Length: 133aa MW: 15533.6 Da PI: 10.2859

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.395470.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	40	8.6e-13	49	96	5	52
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 ++ rr+++NRe+ArrsR RKk +e L+ +v L +N++Lk++l + Cucsa.395470.1 49 RKLRRMISNRESARRSRWRKKRHLEDLTSEVNRLMMQNRELKERLGRV 96 6789****************************************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	3.3E-11	42	95	No hit	No description
SMART	SM00338	1.9E-12	45	109	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.542	47	96	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.5E-10	49	96	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.69E-11	49	102	No hit	No description
CDD	cd14702	3.44E-14	50	97	No hit	No description
PROSITE pattern	PS00036	0	52	67	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 133 aa Download sequence Send to blast
NNHEFTASEI EELLSLFLAN NDGPPSPGSD SQGSMRTSVT NCSTNDDERK LRRMISNRES 60 ARRSRWRKKR HLEDLTSEVN RLMMQNRELK ERLGRVLNSR HMVMRENDWL WMESMGLRAR 120 LSDLCRILAV MQ*

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269\|PubMed:26973252}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681823	1e-165	LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBank	LN713257	1e-165	LN713257.1 Cucumis melo genomic chromosome, chr_3.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004143031.2	2e-90	PREDICTED: light-inducible protein CPRF2
Swissprot	Q9LQ65	2e-15	BZIP4_ARATH; Basic leucine zipper 4
TrEMBL	A0A0A0LKX7	3e-89	A0A0A0LKX7_CUCSA; Uncharacterized protein
STRING	XP_004166742.1	4e-90	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5996	30	52

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G59530.1	2e-17	basic leucine-zipper 4

Link Out ? help Back to Top
Phytozome	Cucsa.395470.1

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Guo YL, et al. Genome-wide comparison of nucleotide-binding site-leucine-rich repeat-encoding genes in Arabidopsis. Plant Physiol., 2011. 157(2): p. 757-69 [PMID:21810963] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Nowak K,Gaj MD Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis. J. Plant Physiol., 2016. 193: p. 119-26 [PMID:26973252] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Ma H, et al. ZmbZIP4 Contributes to Stress Resistance in Maize by Regulating ABA Synthesis and Root Development. Plant Physiol., 2018. 178(2): p. 753-770 [PMID:30126870]