PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa13g003780.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 165aa MW: 18765 Da PI: 5.6419 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 72.6 | 7.4e-23 | 53 | 111 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k++++++d++l+ +isw +g sfvv+d+ efa+++Lp+ Fkh+nf+SFvRQLn+Y Csa13g003780.1 53 FLSKTFDLVDDPTLDPVISWGLTGASFVVWDPLEFARTILPRNFKHNNFSSFVRQLNTY 111 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.4E-24 | 47 | 111 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.77E-21 | 48 | 111 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 2.1E-19 | 49 | 125 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 4.6E-19 | 53 | 111 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 6.2E-13 | 53 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 6.2E-13 | 91 | 103 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 6.2E-13 | 104 | 116 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MSPKKDDFFS KPTPISVPPG PLYCVDTDTM GSPPTPPLPI PLDILQGNQV PPFLSKTFDL 60 VDDPTLDPVI SWGLTGASFV VWDPLEFART ILPRNFKHNN FSSFVRQLNT YIVYMDAAKF 120 LFFFFFPFCF SIFLFVCVSV IFLMILKAHI SCIIVSRNWF FDYL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5hdk_A | 1e-16 | 50 | 118 | 7 | 79 | Heat shock factor protein 2 |
5hdk_B | 1e-16 | 50 | 118 | 7 | 79 | Heat shock factor protein 2 |
5hdk_C | 1e-16 | 50 | 118 | 7 | 79 | Heat shock factor protein 2 |
5hdk_D | 1e-16 | 50 | 118 | 7 | 79 | Heat shock factor protein 2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa13g003780.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AL162506 | 5e-65 | AL162506.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F17C15 (ESSA project). | |||
GenBank | CP002688 | 5e-65 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019089984.1 | 7e-74 | PREDICTED: heat stress transcription factor A-3 | ||||
Swissprot | Q8GYY1 | 1e-51 | HSFA3_ARATH; Heat stress transcription factor A-3 | ||||
TrEMBL | A0A178UJV3 | 4e-52 | A0A178UJV3_ARATH; HSFA3 | ||||
TrEMBL | D7LWT0 | 1e-49 | D7LWT0_ARALL; AT-HSFA3 | ||||
STRING | XP_010452265.1 | 2e-73 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM22902 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G03720.1 | 3e-46 | heat shock transcription factor A3 |