PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_33264_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 73aa MW: 8421.41 Da PI: 6.5261 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 35 | 2.4e-11 | 24 | 72 | 4 | 52 |
-SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS Homeobox 4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 ++++t q+e L + Fe ++++ +++ +L k+lg + +qV +WFqNr Cotton_A_33264_BGI-A2_v1.0 24 KRRLTVIQVEFLDRSFEVENKLASDKKLRLQKELGQQPQQVAIWFQNRH 72 5689999****************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 3.72E-11 | 9 | 72 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 6.3E-12 | 10 | 71 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 12.163 | 18 | 73 | IPR001356 | Homeobox domain |
SMART | SM00389 | 0.0056 | 21 | 73 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 7.2E-9 | 23 | 72 | IPR001356 | Homeobox domain |
CDD | cd00086 | 3.59E-7 | 23 | 73 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
MEYEHVNGGD EDLDGSSQPP GGKKRRLTVI QVEFLDRSFE VENKLASDKK LRLQKELGQQ 60 PQQVAIWFQN RHA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. | |||||
UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016666165.1 | 3e-34 | PREDICTED: homeobox-leucine zipper protein HAT5-like isoform X1 | ||||
Refseq | XP_016666167.1 | 2e-34 | PREDICTED: homeobox-leucine zipper protein HAT5-like isoform X2 | ||||
Refseq | XP_016666168.1 | 2e-34 | PREDICTED: homeobox-leucine zipper protein HAT5-like isoform X2 | ||||
Refseq | XP_017632416.1 | 3e-34 | PREDICTED: homeobox-leucine zipper protein ATHB-54 isoform X1 | ||||
Refseq | XP_017632417.1 | 2e-34 | PREDICTED: homeobox-leucine zipper protein HAT5 isoform X2 | ||||
Swissprot | Q6K498 | 4e-16 | HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4 | ||||
Swissprot | Q9XH37 | 4e-16 | HOX4_ORYSI; Homeobox-leucine zipper protein HOX4 | ||||
TrEMBL | A0A2P5YTR9 | 1e-45 | A0A2P5YTR9_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.005G189800.1 | 3e-32 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM545 | 28 | 143 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65310.2 | 1e-17 | homeobox protein 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|