PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla000767 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 239aa MW: 27899.1 Da PI: 7.523 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.1 | 3.2e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+ eEd++l +v+++G+ W+ ++r g+ R++k+c++rw++yl Cla000767 14 RGAWSLEEDQKLRAYVEKYGPWKWREVPRLAGLMRCGKSCRLRWLNYL 61 89******************88************************97 PP | |||||||
2 | Myb_DNA-binding | 56.6 | 5.8e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ T eE +l+ ++++++G++ W+tIa++++ gRt++++k++w+ + Cla000767 67 RGNYTNEENDLICKLHQKHGNR-WSTIAAKLP-GRTDNEVKNHWNAH 111 899*******************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.069 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.8E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-10 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-21 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.13E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 20.721 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 2.1E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.31E-10 | 69 | 112 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-25 | 69 | 116 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 239 aa Download sequence Send to blast |
MVRAPVVDKD GVKRGAWSLE EDQKLRAYVE KYGPWKWREV PRLAGLMRCG KSCRLRWLNY 60 LQPGLKRGNY TNEENDLICK LHQKHGNRWS TIAAKLPGRT DNEVKNHWNA HLKKQVKPKA 120 ESSTKHQGKL PKQLTSHVFE AKPEDYTEYC STKFGIVESS CLSQQTSSCD DNFGTELNWG 180 VEHYNIDQLN SGYYGDFWTE ACVWEHNETN VFSEDYGIGI FSPQQYETTY DHNYFDLFR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-28 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of cold tolerance. Negatively regulates beta-amylase genes at the transcriptional level in response to cold stress. Suppresses beta-amylase gene expression by interacting with TIFY11A/JAZ9. Maltose produced by beta-amylases has a role in protecting cell membranes under cold stress conditions in rice and may contribute to the cold tolerance as a compatible solute. {ECO:0000269|PubMed:28062835}. | |||||
UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. | |||||
UniProt | INDUCTION: Induced by cold stress and flooding. {ECO:0000269|PubMed:28062835}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681918 | 1e-114 | LN681918.1 Cucumis melo genomic scaffold, anchoredscaffold00020. | |||
GenBank | LN713265 | 1e-114 | LN713265.1 Cucumis melo genomic chromosome, chr_11. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004140052.2 | 1e-143 | PREDICTED: transcription repressor MYB6-like | ||||
Swissprot | Q6K1S6 | 6e-50 | MYB30_ORYSJ; Transcription factor MYB30 | ||||
Swissprot | Q9LTC4 | 1e-49 | MYB15_ARATH; Transcription factor MYB15 | ||||
TrEMBL | A0A0A0KAD1 | 1e-142 | A0A0A0KAD1_CUCSA; Uncharacterized protein | ||||
STRING | XP_004173677.1 | 1e-143 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF356 | 33 | 186 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 4e-52 | myb domain protein 15 |