PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10032627m | ||||||||
Common Name | CICLE_v10032304mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 237aa MW: 27340.5 Da PI: 8.0473 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 102.8 | 4.5e-32 | 8 | 84 | 51 | 128 |
NAM 51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ +ekewyfFs+rd+ky++g+r+nrat sgyWkatg+dk+++ +++ g+kk Lvfykgr pkg ktdW+mheyrl Ciclev10032627m 8 AEFGEKEWYFFSPRDRKYPNGTRPNRATVSGYWKATGTDKAIYG-GSKYLGVKKALVFYKGRPPKGIKTDWIMHEYRL 84 455789**************************************.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 41.49 | 1 | 111 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.2E-39 | 7 | 111 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-14 | 13 | 84 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009825 | Biological Process | multidimensional cell growth | ||||
GO:0009835 | Biological Process | fruit ripening | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 237 aa Download sequence Send to blast |
MYENVEKAEF GEKEWYFFSP RDRKYPNGTR PNRATVSGYW KATGTDKAIY GGSKYLGVKK 60 ALVFYKGRPP KGIKTDWIMH EYRLNDPTRQ PYKHNGSMKL DDWVLCRIYK KRQTGSRSVL 120 DAKVEEDQSC VDQLGKTGGY VEHANASDEQ KLMVKFPRTC SLAHLVELEY FAPISQLLND 180 NTYNFNYDFQ NGINNNAASD DQFENKLQPS DMHQVNHSDS LNQQSLFVNP TVYEFQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-50 | 7 | 117 | 65 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-50 | 7 | 117 | 65 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-50 | 7 | 117 | 65 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-50 | 7 | 117 | 65 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-50 | 7 | 117 | 68 | 174 | NAC domain-containing protein 19 |
3swm_B | 3e-50 | 7 | 117 | 68 | 174 | NAC domain-containing protein 19 |
3swm_C | 3e-50 | 7 | 117 | 68 | 174 | NAC domain-containing protein 19 |
3swm_D | 3e-50 | 7 | 117 | 68 | 174 | NAC domain-containing protein 19 |
3swp_A | 3e-50 | 7 | 117 | 68 | 174 | NAC domain-containing protein 19 |
3swp_B | 3e-50 | 7 | 117 | 68 | 174 | NAC domain-containing protein 19 |
3swp_C | 3e-50 | 7 | 117 | 68 | 174 | NAC domain-containing protein 19 |
3swp_D | 3e-50 | 7 | 117 | 68 | 174 | NAC domain-containing protein 19 |
4dul_A | 3e-50 | 7 | 117 | 65 | 171 | NAC domain-containing protein 19 |
4dul_B | 3e-50 | 7 | 117 | 65 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ccl.3318 | 0.0 | fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00221 | DAP | Transfer from AT1G69490 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF185419 | 0.0 | EF185419.1 Citrus sinensis NAC domain protein (NAC) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006438726.1 | 1e-175 | NAC transcription factor 29 | ||||
Refseq | XP_015387126.1 | 1e-175 | NAC transcription factor 29 isoform X1 | ||||
Swissprot | K4BWV2 | 5e-82 | NAP1_SOLLC; NAC domain-containing protein 1 | ||||
TrEMBL | A0A067GWB3 | 1e-179 | A0A067GWB3_CITSI; Uncharacterized protein | ||||
TrEMBL | V4TF67 | 1e-179 | V4TF67_9ROSI; Uncharacterized protein | ||||
STRING | XP_006438726.1 | 1e-174 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-76 | NAC-like, activated by AP3/PI |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10032627m |
Entrez Gene | 18043968 |
Publications ? help Back to Top | |||
---|---|---|---|
|