PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10003379m | ||||||||
Common Name | CICLE_v10003379mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 201aa MW: 22844.9 Da PI: 4.6927 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 104 | 1.9e-32 | 8 | 126 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGf+F Ptdeelv ++L +k++ +++ ++i+e++ ++Pw+L+ ++ + ++wyfFs+ + +r+t +gyWk+ +++v++ Ciclev10003379m 8 LPPGFKFLPTDEELVLHFLYPKASLLPCHP-NIIPELNPQLHDPWQLNGRALCSGNRWYFFSQIED--------KRVTGNGYWKQLDFEEPVIN 92 79*************************999.89**************976667899******9866........599***************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 + g+++g+kk +vf g+ap g++t+W+m+ey+l Ciclev10003379m 93 SAGKKIGMKKYFVFCVGEAPLGVETNWIMQEYHL 126 ********************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.62E-42 | 6 | 157 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 37.457 | 8 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.4E-21 | 9 | 126 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MCDRTINLPP GFKFLPTDEE LVLHFLYPKA SLLPCHPNII PELNPQLHDP WQLNGRALCS 60 GNRWYFFSQI EDKRVTGNGY WKQLDFEEPV INSAGKKIGM KKYFVFCVGE APLGVETNWI 120 MQEYHLCSCG ASANKSYKRR GNRILGCCKW VLCRVYEEDG NSKGFCHGDD DDDDNGTELS 180 CLDEMFLSLD DDLTDVSFPN * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 8e-33 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 8e-33 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 8e-33 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 8e-33 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 8e-33 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 8e-33 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 8e-33 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 8e-33 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in root xylem vessels (PubMed:15923329). Expressed in stems, vascular tissue of cauline leaves and tracheary elements of sepals (PubMed:18069942). {ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:18069942}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006465058.1 | 1e-149 | NAC domain-containing protein 104-like isoform X3 | ||||
Swissprot | Q8GWK6 | 3e-58 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | V4SCU4 | 1e-148 | V4SCU4_9ROSI; Uncharacterized protein | ||||
STRING | XP_006432173.1 | 1e-148 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3674 | 28 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 1e-58 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10003379m |
Entrez Gene | 18041874 |
Publications ? help Back to Top | |||
---|---|---|---|
|