PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10017952m | ||||||||
Common Name | CARUB_v10017952mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 239aa MW: 27594.8 Da PI: 4.9029 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 54.7 | 1.7e-17 | 33 | 84 | 5 | 56 |
SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +f++eq++ Le Fe++ + +++ + A++lgL+ rqV +WFqN+Ra++k Carubv10017952m 33 KRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWK 84 68*************************************************9 PP | |||||||
2 | HD-ZIP_I/II | 117.5 | 7.6e-38 | 31 | 122 | 2 | 93 |
HD-ZIP_I/II 2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 +++r+s+eq+k+LE Fe+e++Lep++Kv++areLglqprqva+WFqn+RAR+ktkqlEk+++ L+++y++l+++ + ++ke+++L +el++ Carubv10017952m 31 NQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEFNILRASYNNLASQFDIMKKEKQALVSELQR 122 589*************************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 6.94E-17 | 18 | 88 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 8.4E-13 | 23 | 90 | IPR001356 | Homeobox domain |
PROSITE profile | PS50071 | 16.487 | 26 | 86 | IPR001356 | Homeobox domain |
CDD | cd00086 | 8.72E-13 | 32 | 87 | No hit | No description |
Pfam | PF00046 | 7.2E-15 | 33 | 84 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 9.5E-17 | 33 | 92 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 2.8E-5 | 57 | 66 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 61 | 84 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 2.8E-5 | 66 | 82 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 7.4E-16 | 86 | 128 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009615 | Biological Process | response to virus | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 239 aa Download sequence Send to blast |
MEEGDLFNCC FGEINSGGVT MNKKKMKKSY NQKRFSEEQI KSLELIFESE TRLEPRKKVQ 60 VARELGLQPR QVAIWFQNKR ARWKTKQLEK EFNILRASYN NLASQFDIMK KEKQALVSEL 120 QRLNGEMQKP KEKRDHECCG EQGVALSSST ESHNGKCEPE VRLDSEGIVL CNDGDNNNNI 180 IKTEYFGFEE ETDHEFMSIV EKPDDSCLTS SDNWGGFNSD SLLDQSSSSY PNWWEFWS* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:11374882, ECO:0000269|PubMed:15604708}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00013 | PBM | Transfer from AT3G61890 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10017952m |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By water deficit, by abscisic acid (ABA), by cold and salt stress. {ECO:0000269|PubMed:15369784, ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:9617808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY059828 | 0.0 | AY059828.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (F21F14.6) mRNA, complete cds. | |||
GenBank | AY087187 | 0.0 | AY087187.1 Arabidopsis thaliana clone 32615 mRNA, complete sequence. | |||
GenBank | BT002206 | 0.0 | BT002206.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (At3g61890) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006291781.1 | 1e-177 | homeobox-leucine zipper protein ATHB-12 | ||||
Swissprot | Q9M276 | 1e-129 | ATB12_ARATH; Homeobox-leucine zipper protein ATHB-12 | ||||
TrEMBL | R0H5X0 | 1e-175 | R0H5X0_9BRAS; Uncharacterized protein | ||||
STRING | XP_006291781.1 | 1e-176 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2498 | 28 | 74 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G61890.1 | 1e-130 | homeobox 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10017952m |
Entrez Gene | 17887230 |
Publications ? help Back to Top | |||
---|---|---|---|
|