PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G61890.1

Common Name

ATHB12, ATHB-12, F21F14.60, HB-12

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

HD-ZIP

Protein Properties

Length: 235aa MW: 27485.4 Da PI: 4.9093

Description

homeobox 12

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G61890.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	54.8	1.6e-17	32	83	5	56
SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +f++eq++ Le Fe++ + +++ + A++lgL+ rqV +WFqN+Ra++k AT3G61890.1 32 KRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWK 83 68*************************************************9 PP
2	HD-ZIP_I/II	117.9	5.5e-38	30	121	2	93
HD-ZIP_I/II 2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 +++r+s+eq+k+LE Fe+e++Lep++Kv++areLglqprqva+WFqn+RAR+ktkqlEk+y++L+++y++l+++ e ++ke+++L +el++ AT3G61890.1 30 NQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQR 121 689*************************************************************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.92E-17	9	87	IPR009057	Homeodomain-like
SMART	SM00389	7.9E-13	22	89	IPR001356	Homeobox domain
PROSITE profile	PS50071	16.665	25	85	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	6.6E-17	31	92	IPR009057	Homeodomain-like
Pfam	PF00046	1.5E-14	32	83	IPR001356	Homeobox domain
CDD	cd00086	7.57E-13	33	86	No hit	No description
PRINTS	PR00031	2.7E-5	56	65	IPR000047	Helix-turn-helix motif
PROSITE pattern	PS00027	0	60	83	IPR017970	Homeobox, conserved site
PRINTS	PR00031	2.7E-5	65	81	IPR000047	Helix-turn-helix motif
Pfam	PF02183	1.9E-15	85	127	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development
GO:0009414	Biological Process	response to water deprivation
GO:0009615	Biological Process	response to virus
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000016	anatomy	lateral root primordium
PO:0000017	anatomy	vascular leaf primordium
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0006343	anatomy	axillary shoot system
PO:0008019	anatomy	leaf lamina base
PO:0009001	anatomy	fruit
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0009053	anatomy	peduncle
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 235 aa Download sequence Send to blast
MEEGDFFNCC FSEISSGMTM NKKKMKKSNN QKRFSEEQIK SLELIFESET RLEPRKKVQV 60 ARELGLQPRQ VAIWFQNKRA RWKTKQLEKE YNTLRANYNN LASQFEIMKK EKQSLVSELQ 120 RLNEEMQRPK EEKHHECCGD QGLALSSSTE SHNGKSEPEG RLDQGSVLCN DGDYNNNIKT 180 EYFGFEEETD HELMNIVEKA DDSCLTSSEN WGGFNSDSLL DQSSSNYPNW WEFWS

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.25517	0.0	floral meristem

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30695507	0.0
Genevisible	251272_at	0.0
Expression Atlas	AT3G61890	-
AtGenExpress	AT3G61890	-
ATTED-II	AT3G61890	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed. {ECO:0000269\|PubMed:16055682, ECO:0000269\|PubMed:9617808}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a homeodomain leucine zipper class I (HD-Zip I) protein. Loss of function mutant has abnormally shaped leaves and stems.
UniProt	Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269\|PubMed:11374882, ECO:0000269\|PubMed:15604708}.

Function -- GeneRIF ? help Back to Top
ATHB12 negatively regulates the expression of a gibberellin 20-oxidase gene in inflorescence stems. [PMID: 20668225] results suggest that ATHB7 and ATHB12 may play an important role in the activation of the abnormal cell division associated with symptom development during geminivirus infection [PMID: 21625602] demonstrate that ATHB7 and ATHB12 have essential functions in the primary response to drought, as mediators of a negative feedback effect on ABA signalling in the plant response to water deficit [PMID: 22968620] The results suggested that AtHB7 and AtHB12 evolved divergently to fine tune processes associated with development and responses to mild water stress. [PMID: 24884528] ATHB12 acts as a positive regulator of endoreduplication and cell growth during leaf development. [PMID: 25187356]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00013	PBM	24477691	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G61890.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By water deficit, by abscisic acid (ABA), by cold and salt stress. {ECO:0000269\|PubMed:15369784, ECO:0000269\|PubMed:16055682, ECO:0000269\|PubMed:9617808}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT4G25420(R)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G37260, AT5G54230, AT5G65310, AT1G10585, AT1G53170

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G61890

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY059828	0.0	AY059828.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (F21F14.6) mRNA, complete cds.
GenBank	AY087187	0.0	AY087187.1 Arabidopsis thaliana clone 32615 mRNA, complete sequence.
GenBank	BT002206	0.0	BT002206.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (At3g61890) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_191748.1	1e-174	homeobox 12
Swissprot	Q9M276	1e-175	ATB12_ARATH; Homeobox-leucine zipper protein ATHB-12
TrEMBL	A0A178VND2	1e-173	A0A178VND2_ARATH; HB-12
STRING	AT3G61890.1	1e-174	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2498	28	74
Representative plant	OGRP129	16	189

Link Out ? help Back to Top
Phytozome	AT3G61890.1
Entrez Gene	825362
iHOP	AT3G61890
wikigenes	AT3G61890

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Johannesson H,Wang Y,Engström P DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro. Plant Mol. Biol., 2001. 45(1): p. 63-73 [PMID:11247607] Lee YH, et al. Structure and expression of the Arabidopsis thaliana homeobox gene Athb-12. Biochem. Biophys. Res. Commun., 2001. 284(1): p. 133-41 [PMID:11374882] Bray EA Classification of genes differentially expressed during water-deficit stress in Arabidopsis thaliana: an analysis using microarray and differential expression data. Ann. Bot., 2002. 89 Spec No: p. 803-11 [PMID:12102506] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Shin D, et al. Athb-12, a homeobox-leucine zipper domain protein from Arabidopsis thaliana, increases salt tolerance in yeast by regulating sodium exclusion. Biochem. Biophys. Res. Commun., 2004. 323(2): p. 534-40 [PMID:15369784] Olsson AS,Engström P,Söderman E The homeobox genes ATHB12 and ATHB7 encode potential regulators of growth in response to water deficit in Arabidopsis. Plant Mol. Biol., 2004. 55(5): p. 663-77 [PMID:15604708] Henriksson E, et al. Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships. Plant Physiol., 2005. 139(1): p. 509-18 [PMID:16055682] Moes D,Himmelbach A,Korte A,Haberer G,Grill E Nuclear localization of the mutant protein phosphatase abi1 is required for insensitivity towards ABA responses in Arabidopsis. Plant J., 2008. 54(5): p. 806-19 [PMID:18298671] Huang D,Wu W,Abrams SR,Cutler AJ The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. J. Exp. Bot., 2008. 59(11): p. 2991-3007 [PMID:18552355] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Son O, et al. ATHB12, an ABA-inducible homeodomain-leucine zipper (HD-Zip) protein of Arabidopsis, negatively regulates the growth of the inflorescence stem by decreasing the expression of a gibberellin 20-oxidase gene. Plant Cell Physiol., 2010. 51(9): p. 1537-47 [PMID:20668225] Park J, et al. The Arabidopsis thaliana homeobox gene ATHB12 is involved in symptom development caused by geminivirus infection. PLoS ONE, 2011. 6(5): p. e20054 [PMID:21625602] Vald The homeodomain-leucine zipper (HD-Zip) class I transcription factors ATHB7 and ATHB12 modulate abscisic acid signalling by regulating protein phosphatase 2C and abscisic acid receptor gene activities. Plant Mol. Biol., 2012. 80(4-5): p. 405-18 [PMID:22968620] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Capella M,R Plant homeodomain-leucine zipper I transcription factors exhibit different functional AHA motifs that selectively interact with TBP or/and TFIIB. Plant Cell Rep., 2014. 33(6): p. 955-67 [PMID:24531799] Lumba S, et al. A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis. Dev. Cell, 2014. 29(3): p. 360-72 [PMID:24823379] R Arabidopsis AtHB7 and AtHB12 evolved divergently to fine tune processes associated with growth and responses to water stress. BMC Plant Biol., 2014. 14: p. 150 [PMID:24884528] Hur YS, et al. Arabidopsis thaliana homeobox 12 (ATHB12), a homeodomain-leucine zipper protein, regulates leaf growth by promoting cell expansion and endoreduplication. New Phytol., 2015. 205(1): p. 316-28 [PMID:25187356] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615] Lee YH,Chun JY A new homeodomain-leucine zipper gene from Arabidopsis thaliana induced by water stress and abscisic acid treatment. Plant Mol. Biol., 1998. 37(2): p. 377-84 [PMID:9617808]