PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10010134m | ||||||||
Common Name | CARUB_v100101340mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 28114.7 Da PI: 7.6343 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.7 | 2.3e-31 | 12 | 61 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s Carubv10010134m 12 RIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 61 8***********************************************96 PP | |||||||
2 | K-box | 81.2 | 2.3e-27 | 96 | 165 | 16 | 85 |
K-box 16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 s+qqe+ kLk++++ Lqr+qR+llGedL++Ls keL++Le+qL++slk+iR+ +++++l+q+++lq k Carubv10010134m 96 SSQQEYLKLKERYDALQRTQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKLA 165 68****************************************************************9975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00404 | 2.0E-26 | 5 | 25 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.49E-30 | 10 | 79 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.11E-40 | 11 | 79 | No hit | No description |
SMART | SM00432 | 4.2E-31 | 11 | 62 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.202 | 11 | 63 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.3E-26 | 12 | 59 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-26 | 25 | 40 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-26 | 40 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.23 | 94 | 199 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.6E-21 | 97 | 163 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MRASLVHNNW RRIENKINRQ VTFAKRRNGL LKKAYELSVL CDAEVALIIF SNRGKLYEFC 60 SSSSSMLRTL ERYQKCNYGA PEPNVPSREA LAVELSSQQE YLKLKERYDA LQRTQRNLLG 120 EDLGPLSSKE LESLERQLDS SLKQIRALRT QFMLDQLNDL QSKLADGYQM PLQLNPNPED 180 HVDHYARHHH QQQHQHSQAF FQPLECEPIL QIGYQGQQDH GMGAGPSVNN YMLGWLPYDT 240 NSI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ox0_A | 4e-53 | 78 | 163 | 1 | 86 | Developmental protein SEPALLATA 3 |
4ox0_B | 4e-53 | 78 | 163 | 1 | 86 | Developmental protein SEPALLATA 3 |
4ox0_C | 4e-53 | 78 | 163 | 1 | 86 | Developmental protein SEPALLATA 3 |
4ox0_D | 4e-53 | 78 | 163 | 1 | 86 | Developmental protein SEPALLATA 3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor active in inflorescence development and floral organogenesis. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00605 | ChIP-seq | Transfer from AT1G24260 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10010134m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF015552 | 0.0 | AF015552.1 Arabidopsis thaliana MADS-box (AGL9) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019099223.1 | 1e-155 | PREDICTED: developmental protein SEPALLATA 3 isoform X5 | ||||
Swissprot | O04067 | 1e-149 | AGL9_SINAL; Agamous-like MADS-box protein AGL9 homolog | ||||
TrEMBL | R0IMY8 | 1e-171 | R0IMY8_9BRAS; Uncharacterized protein (Fragment) | ||||
STRING | XP_006305560.1 | 1e-172 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6220 | 26 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G24260.3 | 1e-152 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10010134m |
Entrez Gene | 17898801 |
Publications ? help Back to Top | |||
---|---|---|---|
|