PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

MYB

Protein Properties

Length: 281aa MW: 31670.2 Da PI: 6.4368

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cagra.4395s0068.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.7	2.3e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl Cagra.4395s0068.1.p 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLMRCSKSCRLRWTNYL 61 79********************************************97 PP
2	Myb_DNA-binding	46.4	9.3e-15	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l Cagra.4395s0068.1.p 67 RGNFTPHEEGMIIHLQALLGNK-WASIASYLP-QRTDNDIKNYWNTHL 112 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.2E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	25.334	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	1.28E-30	11	108	IPR009057	Homeodomain-like
SMART	SM00717	2.1E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	4.5E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	6.71E-11	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.7E-25	65	117	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.239	66	116	IPR017930	Myb domain
SMART	SM00717	4.2E-13	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	4.3E-13	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	7.66E-9	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009414	Biological Process	response to water deprivation
GO:0009416	Biological Process	response to light stimulus
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010118	Biological Process	stomatal movement
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 281 aa Download sequence Send to blast
MGRPPCCDKI GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLMRCS KSCRLRWTNY 60 LRPGIKRGNF TPHEEGMIIH LQALLGNKWA SIASYLPQRT DNDIKNYWNT HLKKKLNKSE 120 CDQERSRSSE NMTLQTSATR NTINHRSTYA SSTENISRLL EGWMRASPKS STANFLEQKM 180 QNHQTNNLMD QSPYEQLQGS WEEAGHHSKR SNGGLGAGPK TTENNIGGDH EDGGDDDEEE 240 EHNATPPLTF IEKWLLEETS ATAGGQMEEM SHLMELSNML *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	6e-24	14	116	4	105	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	6e-24	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:21637967}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00132	DAP	Transfer from AT1G08810	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Cagra.4395s0068.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:21637967, ECO:0000269\|PubMed:23453954, ECO:0000269\|PubMed:23828545, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117469	0.0	AK117469.1 Arabidopsis thaliana At1g08810 mRNA for putative transcription factor, complete cds, clone: RAFL17-08-C21.
GenBank	AY519551	0.0	AY519551.1 Arabidopsis thaliana MYB transcription factor (At1g08810) mRNA, complete cds.
GenBank	BT005074	0.0	BT005074.1 Arabidopsis thaliana clone U50259 putative myb family transcription factor (At1g08810) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006305493.1	0.0	myb-related protein 306
Swissprot	Q8GYP5	1e-158	MYB60_ARATH; Transcription factor MYB60
TrEMBL	R0GRH1	0.0	R0GRH1_9BRAS; Uncharacterized protein
STRING	Cagra.4395s0068.1.p	0.0	(Capsella grandiflora)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08810.1	1e-159	myb domain protein 60

Link Out ? help Back to Top
Phytozome	Cagra.4395s0068.1.p

Publications ? help Back to Top
Galbiati M, et al. Gene trap lines identify Arabidopsis genes expressed in stomatal guard cells. Plant J., 2008. 53(5): p. 750-62 [PMID:18036199] Rusconi F, et al. The Arabidopsis thaliana MYB60 promoter provides a tool for the spatio-temporal control of gene expression in stomatal guard cells. J. Exp. Bot., 2013. 64(11): p. 3361-71 [PMID:23828545] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim D,Ntui VO,Xiong L Arabidopsis YAK1 regulates abscisic acid response and drought resistance. FEBS Lett., 2016. 590(14): p. 2201-9 [PMID:27264339]