![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.2629s0008.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 82aa MW: 9298.56 Da PI: 8.4932 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.9 | 8.4e-17 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd ll +++ ++G g W++++ + g++R+ k+c++rw++yl Cagra.2629s0008.1.p 10 KGAWTAEEDSLLRKCIDKYGEGKWHKVPLRAGLNRSCKSCRERWLNYL 57 79*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.0E-23 | 5 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.588 | 5 | 61 | IPR017930 | Myb domain |
SMART | SM00717 | 3.2E-15 | 9 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-15 | 10 | 57 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.28E-19 | 11 | 73 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.56E-12 | 12 | 57 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
MEGSSEGLRK GAWTAEEDSL LRKCIDKYGE GKWHKVPLRA GLNRSCKSCR ERWLNYLNPN 60 IKRGEFGSDE VDLLSFAFIS F* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.2629s0008.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006302766.1 | 6e-45 | transcription factor MYB114 | ||||
Swissprot | Q9FNV8 | 2e-38 | MY114_ARATH; Transcription factor MYB114 | ||||
TrEMBL | R0I0F5 | 1e-43 | R0I0F5_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.2629s0008.1.p | 2e-53 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66380.1 | 8e-41 | myb domain protein 114 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.2629s0008.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|