PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CCG012442.1

Organism

Populus euphratica

Taxonomic ID

75702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

NAC

Protein Properties

Length: 163aa MW: 19031.5 Da PI: 9.2865

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CCG012442.1	genome	LZU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	161.4	3.5e-50	14	140	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk... 95 lppGfrF+Ptdeelv +yLk+k+ + +l++ +vi+ev+++k++Pw+Lp e+e yfFs++++ky++g+r nr+ +sgyWkatg dk+++s+ CCG012442.1 14 LPPGFRFQPTDEELVFQYLKRKILSWPLPA-SVIHEVNVCKYDPWELPGD---MEQERYFFSNKETKYPNGNRVNRSSASGYWKATGLDKQIVSSswk 107 79**************************.99***********54...46799********************************9888 PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ vg+kktLvfy+g+a +g++tdWvmheyrl CCG012442.1 108 NNHIVGMKKTLVFYRGKATHGSRTDWVMHEYRL 140 8889*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.22E-53	10	142	IPR003441	NAC domain
PROSITE profile	PS51005	51.357	14	155	IPR003441	NAC domain
Pfam	PF02365	3.2E-26	15	140	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 163 aa Download sequence Send to blast
MEKLNFVRDG KIRLPPGFRF QPTDEELVFQ YLKRKILSWP LPASVIHEVN VCKYDPWELP 60 GDMEQERYFF SNKETKYPNG NRVNRSSASG YWKATGLDKQ IVSSSWKNNH IVGMKKTLVF 120 YRGKATHGSR TDWVMHEYRL VNVGEETTDC NFPQTENSAQ ASY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	9e-44	11	141	14	143	NO APICAL MERISTEM PROTEIN
1ut4_B	9e-44	11	141	14	143	NO APICAL MERISTEM PROTEIN
1ut7_A	9e-44	11	141	14	143	NO APICAL MERISTEM PROTEIN
1ut7_B	9e-44	11	141	14	143	NO APICAL MERISTEM PROTEIN
3swm_A	1e-43	11	141	17	146	NAC domain-containing protein 19
3swm_B	1e-43	11	141	17	146	NAC domain-containing protein 19
3swm_C	1e-43	11	141	17	146	NAC domain-containing protein 19
3swm_D	1e-43	11	141	17	146	NAC domain-containing protein 19
3swp_A	1e-43	11	141	17	146	NAC domain-containing protein 19
3swp_B	1e-43	11	141	17	146	NAC domain-containing protein 19
3swp_C	1e-43	11	141	17	146	NAC domain-containing protein 19
3swp_D	1e-43	11	141	17	146	NAC domain-containing protein 19
4dul_A	9e-44	11	141	14	143	NAC domain-containing protein 19
4dul_B	9e-44	11	141	14	143	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078, ECO:0000269\|PubMed:24442717}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269\|PubMed:21673078}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KP770013	0.0	KP770013.1 Populus tomentosa trans-cinnamate 4-monooxygenase (Potri.015G102100) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011023926.1	1e-120	PREDICTED: NAC transcription factor 25-like
Swissprot	Q9FY93	1e-70	NAC83_ARATH; NAC domain-containing protein 83
TrEMBL	A0A0F6V052	1e-112	A0A0F6V052_POPTO; Trans-cinnamate 4-monooxygenase
STRING	POPTR_0012s10530.1	1e-108	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF704	34	139

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13180.1	5e-73	NAC domain containing protein 83

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]