PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi2g04590.1.p | ||||||||
Common Name | BRADI_2g04590, LOC100825301 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 187aa MW: 19803.8 Da PI: 10.7124 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 38.5 | 2.6e-12 | 95 | 155 | 2 | 62 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 ke r +r+ +NR++A+ R+RKka++ eLe k+k Le N +L +++++l++e +l++ Bradi2g04590.1.p 95 KEQNRLKRLLRNRVSAQQARERKKAYMTELEVKAKDLELRNAELEQKVSTLQNENNTLRQI 155 78899***************************************************99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.4E-12 | 94 | 158 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.1E-11 | 95 | 156 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 12.059 | 96 | 159 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.81E-12 | 99 | 156 | No hit | No description |
CDD | cd14704 | 1.98E-15 | 99 | 149 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.4E-16 | 99 | 158 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 101 | 116 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MAAQEQEQEK QQAKTSTTSS LPSSSERSSS SGPNNLKEGG AESDEEIRRV PEMGGGSASS 60 GAGDGKQLLL QQHGAGGQPP ASASGKKRGR AAGDKEQNRL KRLLRNRVSA QQARERKKAY 120 MTELEVKAKD LELRNAELEQ KVSTLQNENN TLRQILKNTT AHAGKKSGGG GKGGDGGKKQ 180 HHFSKS* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 84 | 90 | GKKRGRA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi2g04590.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK365648 | 1e-144 | AK365648.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2035O05. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003569436.1 | 1e-129 | transcription factor HY5 | ||||
Swissprot | Q9SM50 | 5e-43 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | I1HCH7 | 1e-127 | I1HCH7_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G04590.1 | 1e-128 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1408 | 38 | 111 | Representative plant | OGRP2081 | 17 | 37 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11260.1 | 3e-34 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi2g04590.1.p |
Entrez Gene | 100825301 |
Publications ? help Back to Top | |||
---|---|---|---|
|