PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA011363-PA | ||||||||
Common Name | ILI6, OsI_10199 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 92aa MW: 10392.7 Da PI: 7.3656 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 21.7 | 3.6e-07 | 20 | 59 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 +i + ++L++llP+a ++ ++ + +L+++++YI+sL BGIOSGA011363-PA 20 QISDLVSKLQDLLPEARLRSNDRVPSSRVLQETCNYIRSL 59 789999*********8899*******************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.280.10 | 2.3E-8 | 4 | 78 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
PROSITE profile | PS50888 | 9.813 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 5.63E-9 | 19 | 81 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 2.6E-4 | 20 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009640 | Biological Process | photomorphogenesis | ||||
GO:0009742 | Biological Process | brassinosteroid mediated signaling pathway | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0080113 | Biological Process | regulation of seed growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MSSRRSRSRQ SGSSRITDEQ ISDLVSKLQD LLPEARLRSN DRVPSSRVLQ ETCNYIRSLH 60 QEVDDLSERL SELLATSDMS SAQAAIIRSL LM |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.52845 | 1e-157 | flower| root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 32979593 | 1e-157 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}. | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK069569 | 1e-155 | AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015629922.1 | 8e-57 | transcription factor ILI6 isoform X7 | ||||
Swissprot | B8APB5 | 7e-58 | ILI6_ORYSI; Transcription factor ILI6 | ||||
Swissprot | Q0DUR2 | 7e-58 | ILI6_ORYSJ; Transcription factor ILI6 | ||||
TrEMBL | A0A0D3FEE4 | 2e-55 | A0A0D3FEE4_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0CVV1 | 2e-55 | A0A0E0CVV1_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0GHG8 | 2e-55 | A0A0E0GHG8_ORYNI; Uncharacterized protein | ||||
TrEMBL | A0A0E0NQC5 | 2e-55 | A0A0E0NQC5_ORYRU; Uncharacterized protein | ||||
TrEMBL | I1P815 | 2e-55 | I1P815_ORYGL; Uncharacterized protein | ||||
STRING | OMERI03G05010.1 | 3e-56 | (Oryza meridionalis) | ||||
STRING | OS03T0171300-01 | 3e-56 | (Oryza sativa) | ||||
STRING | ORGLA03G0051100.1 | 3e-56 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2675 | 33 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 6e-34 | bHLH family protein |