PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA006773-PA
Common NameOsI_06594
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 255aa    MW: 25778.4 Da    PI: 8.9119
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA006773-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.74e-3645101662
            zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         cprC+s +tkfCyynnys++qPryfC++CrryWt+GG+lrnvPvGgg+rk+k+ss
  BGIOSGA006773-PA  45 PCCPRCNSIKTKFCYYNNYSMAQPRYFCRECRRYWTQGGSLRNVPVGGGCRKSKRSS 101
                       569***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.0814599IPR003851Zinc finger, Dof-type
PfamPF027015.6E-314699IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-254799IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MASGGALSPV EEKPAVVKTT KAEQHEEEAA VAVKSAAEMM KKSSPCCPRC NSIKTKFCYY  60
NNYSMAQPRY FCRECRRYWT QGGSLRNVPV GGGCRKSKRS SASSASASAA SPPAPAVGAA  120
APPVVPALSS AISKLLQSEP MAAPCADFPN VLPTFVSTGF ELPAAAGDRL SLGSFGAFGN  180
LSAAVAAPGG GGGSSTTTSF MDMLRGVGGL FDGVGNSHQM GGNGGGGGSY YAPLITGAGN  240
GMLMPPPPLP PFSVL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41840.0flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3092430640.0
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in developing seeds from 5 to 30 days after flowering (DAF) (PubMed:16798940). Expressed in germinating seeds up to 5 days after imbibition (PubMed:11470159). {ECO:0000269|PubMed:11470159, ECO:0000269|PubMed:16798940}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA consensus core sequence 5'-AAAG-3' also known as prolamin box (PubMed:16798940). Can activate the expression of genes encoding for the seed storage proteins glutelin, prolamin and globulin. Functions synergistically with RISBZ/BZIP58 to positively regulate quantitatively many seed storage proteins (PubMed:16798940, PubMed:19473328). Functions synergistically with RISBZ1/BZIP58 to positively regulate some metabolic enzymes, such as alanine aminotransferase and pyruvate phosphate dikinase, that are expressed in developing seeds (PubMed:16798940). Functions synergistically with RISBZ1/BZIP58 to positively regulate genes that are key players in the development of aleurone layers (PubMed:19473328). Functions synergistically with RISBZ1/BZIP58 to positively regulate the glutelin GLUD-1 gene in endosperm of developing seeds (PubMed:18980953). Can activate the expression of the bifunctional lysine-degrading enzyme, lysine ketoglutarate reductase/saccharopine dehydrogenase (LKR/SDH), one of the key regulators determining free lysine content in plants (PubMed:21037241). In germinating seeds, involved in the gibberellin-mediated activation of the alpha-amylase AMY1.1/AMY1A gene (PubMed:14500792). {ECO:0000269|PubMed:14500792, ECO:0000269|PubMed:16798940, ECO:0000269|PubMed:18980953, ECO:0000269|PubMed:19473328, ECO:0000269|PubMed:21037241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:11470159, ECO:0000269|PubMed:16798940}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623741.11e-131dof zinc finger protein 3-like
SwissprotQ6K5371e-132DOF3_ORYSJ; Dof zinc finger protein 3
TrEMBLB8AFC30.0B8AFC3_ORYSI; Uncharacterized protein
STRINGONIVA02G12020.11e-180(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP173981010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.16e-30Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]
  2. Washio K
    Functional dissections between GAMYB and Dof transcription factors suggest a role for protein-protein associations in the gibberellin-mediated expression of the RAmy1A gene in the rice aleurone.
    Plant Physiol., 2003. 133(2): p. 850-63
    [PMID:14500792]
  3. Yamamoto MP,Onodera Y,Touno SM,Takaiwa F
    Synergism between RPBF Dof and RISBZ1 bZIP activators in the regulation of rice seed expression genes.
    Plant Physiol., 2006. 141(4): p. 1694-707
    [PMID:16798940]
  4. Kawakatsu T,Yamamoto MP,Hirose S,Yano M,Takaiwa F
    Characterization of a new rice glutelin gene GluD-1 expressed in the starchy endosperm.
    J. Exp. Bot., 2008. 59(15): p. 4233-45
    [PMID:18980953]
  5. Kawakatsu T,Yamamoto MP,Touno SM,Yasuda H,Takaiwa F
    Compensation and interaction between RISBZ1 and RPBF during grain filling in rice.
    Plant J., 2009. 59(6): p. 908-20
    [PMID:19473328]
  6. Kawakatsu T,Takaiwa F
    Differences in transcriptional regulatory mechanisms functioning for free lysine content and seed storage protein accumulation in rice grain.
    Plant Cell Physiol., 2010. 51(12): p. 1964-74
    [PMID:21037241]
  7. Gaur VS,Singh US,Kumar A
    Transcriptional profiling and in silico analysis of Dof transcription factor gene family for understanding their regulation during seed development of rice Oryza sativa L.
    Mol. Biol. Rep., 2011. 38(4): p. 2827-48
    [PMID:21113680]
  8. Schmidt R, et al.
    SALT-RESPONSIVE ERF1 is a negative regulator of grain filling and gibberellin-mediated seedling establishment in rice.
    Mol Plant, 2014. 7(2): p. 404-21
    [PMID:24046061]
  9. Fan J, et al.
    Infection of Ustilaginoidea virens intercepts rice seed formation but activates grain-filling-related genes.
    J Integr Plant Biol, 2015. 57(6): p. 577-90
    [PMID:25319482]
  10. Sutoh K, et al.
    An N-terminal region of a Myb-like protein is involved in its intracellular localization and activation of a gibberellin-inducible proteinase gene in germinated rice seeds.
    Biosci. Biotechnol. Biochem., 2015. 79(5): p. 747-59
    [PMID:25559339]