PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araip.7X35U | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 95aa MW: 10497.8 Da PI: 8.2245 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 56.6 | 1e-17 | 13 | 47 | 4 | 38 |
DUF702 4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCath 38 +++C dCGnqakkdC+++RCRtCCk++gf+C th Araip.7X35U 13 FSSKCSDCGNQAKKDCSYTRCRTCCKNKGFHCPTH 47 5679******************************* PP | |||||||
2 | DUF702 | 53.3 | 1e-16 | 48 | 86 | 104 | 142 |
DUF702 104 slPeevsseavfrcvrvssvddgeeelaYqtavsigGhv 142 ++P+ +ss a+frcvrv+s+d++ +e+aYqt+v+igGh Araip.7X35U 48 EFPASMSSVAIFRCVRVRSMDESVNEIAYQTSVNIGGHA 86 79************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 1.1E-13 | 15 | 47 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 6.1E-18 | 16 | 47 | IPR006510 | Zinc finger, lateral root primordium type 1 |
Pfam | PF05142 | 9.8E-12 | 48 | 86 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01624 | 1.6E-14 | 49 | 85 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MEGQEALKGN SSFSSKCSDC GNQAKKDCSY TRCRTCCKNK GFHCPTHEFP ASMSSVAIFR 60 CVRVRSMDES VNEIAYQTSV NIGGHALINH HHQTP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araip.7X35U |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027357012.1 | 1e-33 | protein SHI RELATED SEQUENCE 3-like | ||||
Swissprot | Q9SJT8 | 9e-25 | SRS3_ARATH; Protein SHI RELATED SEQUENCE 3 | ||||
TrEMBL | K7KHH5 | 2e-30 | K7KHH5_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA04G01125.1 | 3e-31 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF30470 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G21400.1 | 4e-27 | SHI-related sequence3 |