PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.62DXS | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 244aa MW: 26880.7 Da PI: 8.8426 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.2 | 1.9e-18 | 35 | 80 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd +l ++v+++G ++W++I+r++ gR++k+c++rw + Aradu.62DXS 35 KGPWSAEEDRILTRLVERYGARNWSLISRYIK-GRSGKSCRLRWCNQ 80 79*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 55 | 1.9e-17 | 89 | 131 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +++ Ed+ ++ a++q+G++ W+tIar ++ gRt++ +k++w++ Aradu.62DXS 89 PFSSHEDDTIIAAHAQYGNR-WATIARLLP-GRTDNAVKNHWNST 131 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.681 | 30 | 85 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.72E-31 | 32 | 128 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-16 | 34 | 83 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-17 | 35 | 80 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-24 | 36 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.25E-15 | 37 | 79 | No hit | No description |
SMART | SM00717 | 1.1E-14 | 86 | 134 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.499 | 87 | 136 | IPR017930 | Myb domain |
CDD | cd00167 | 1.29E-11 | 89 | 132 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.2E-22 | 89 | 135 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.5E-13 | 89 | 131 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MEALNNRSSS CTASSSDSSS SESTQRNPNR PERIKGPWSA EEDRILTRLV ERYGARNWSL 60 ISRYIKGRSG KSCRLRWCNQ LSPTVEHRPF SSHEDDTIIA AHAQYGNRWA TIARLLPGRT 120 DNAVKNHWNS TLKRRARDQR RGGSATGVHA TCASLAAAPT NERASCSSGA LPPCTLPLED 180 DPLTALTLAP PGIDRGSGAM EAEQQRASPE TSVGSGFWDV MRDVIAREVR EYVSSNFSDH 240 SNFH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-41 | 31 | 136 | 3 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.62DXS |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF208655 | 0.0 | KF208655.1 Arachis hypogaea putative R2R3 MYB protein 1 (MYB1) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015934294.1 | 1e-180 | transcription factor MYB44 | ||||
Swissprot | O23160 | 6e-55 | MYB73_ARATH; Transcription factor MYB73 | ||||
Swissprot | Q9SN12 | 5e-55 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | V5T6N4 | 1e-178 | V5T6N4_ARAHY; Putative R2R3 MYB protein 1 | ||||
STRING | GLYMA06G04010.1 | 1e-103 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5074 | 32 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 4e-57 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|