PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn181521 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 163aa MW: 18031 Da PI: 5.3814 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 157.5 | 2.1e-49 | 26 | 120 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 eq+r+lPianv+rimk++lP akisk+ake +qec++efisfvt+easdkc++e+rkt+ngdd++wal++lGf+dy+e++ yl kyre+++e+ Achn181521 26 EQERLLPIANVGRIMKQTLPPSAKISKEAKERMQECATEFISFVTGEASDKCHKENRKTVNGDDVCWALSSLGFDDYAEAIGRYLCKYREFDRER 120 89*****************************************************************************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.3E-48 | 20 | 138 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.77E-38 | 27 | 147 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.7E-25 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.8E-17 | 58 | 76 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.8E-17 | 77 | 95 | No hit | No description |
PRINTS | PR00615 | 4.8E-17 | 96 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MSPLKAHYGG PVGKSEDQSN PNMDDEQERL LPIANVGRIM KQTLPPSAKI SKEAKERMQE 60 CATEFISFVT GEASDKCHKE NRKTVNGDDV CWALSSLGFD DYAEAIGRYL CKYREFDRER 120 ANQNKGRTNG DNDEASSYKG DSSIPLEYRV LEKGGSSLTK PS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-40 | 26 | 115 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-40 | 26 | 115 | 3 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00133 | DAP | Transfer from AT1G09030 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028060827.1 | 7e-76 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 1e-55 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A2R6RAK3 | 1e-100 | A0A2R6RAK3_ACTCH; Nuclear transcription factor Y subunit B-4 like | ||||
STRING | VIT_14s0060g02660.t01 | 4e-71 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 5e-58 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|