PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan019777
Organism
Artemisia annua
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family TCP
Protein Properties Length: 185aa    MW: 20435.1 Da    PI: 8.2799
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-37655PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP126.82.2e-3966140276
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceae 76 
                ++k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++tieWLlqqa+p+++++tgt++++a++++ +
  Aan019777  66 PPKRTSTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKTDGETIEWLLQQAEPSVIAATGTGTIPANFTSLK 140
                789******************************************************************988333 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-3470144IPR005333Transcription factor, TCP
PROSITE profilePS5136927.49772126IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MDGSHDHFHH RPNFPFQLLE KKDDEACTSS ATTTTTTIYP SLTIATDTTT AAAVAGSSTD  60
LSNKQPPKRT STKDRHTKVD GRGRRIRMPA LCAARVFQLT RELGHKTDGE TIEWLLQQAE  120
PSVIAATGTG TIPANFTSLK SHYEALDRVY RPLLISDPPI STPILLSHKE EIIQVSVQII  180
HPRIN
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in archespores, pollen mother cell, ovule primordia and megaspore mother cells (PubMed:25527103). Expressed in young proliferating tissues (PubMed:21668538). Expressed in developing embryos, and seeds during germination (PubMed:25655823). {ECO:0000269|PubMed:21668538, ECO:0000269|PubMed:25527103, ECO:0000269|PubMed:25655823}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved the regulation of plant development. Together with TCP14, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in developing leaf blade and specific floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Involved in gynoecium and silique development. Modulates the development of the different tissues of the gynoecium through its participation in auxin and cytokinin responses. Modulates the expression of the cytokinin-responsive genes ARR7 and ARR15. May repress the expression of the auxin biosynthetic genes YUC1 and YUC4 (PubMed:26303297). Acts as negative regulator of anthocyanin accumulation under high light conditions. Modulates the expression of transcription factors involved in the induction of anthocyanin biosynthesis genes (PubMed:26574599). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). {ECO:0000269|PubMed:21668538, ECO:0000269|PubMed:22267487, ECO:0000269|PubMed:24689742, ECO:0000269|PubMed:25655823, ECO:0000269|PubMed:25757472, ECO:0000269|PubMed:26303297, ECO:0000269|PubMed:26574599}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation with the lowest expression in the middle of the dark period (PubMed:21183706). Induced during seed imbibition (PubMed:25655823). Induced by cytokinin (PubMed:26303297). {ECO:0000269|PubMed:21183706, ECO:0000269|PubMed:25655823, ECO:0000269|PubMed:26303297}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021978439.14e-71transcription factor TCP15-like
RefseqXP_023738585.16e-71transcription factor TCP14-like
SwissprotQ9C9L23e-49TCP15_ARATH; Transcription factor TCP15
TrEMBLA0A291NF653e-81A0A291NF65_CHRMO; TCP14
STRINGVIT_17s0000g06020.t012e-60(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.13e-48TCP family protein
Publications ? help Back to Top
  1. Steiner E, et al.
    The Putative O-Linked N-Acetylglucosamine Transferase SPINDLY Inhibits Class I TCP Proteolysis to Promote Sensitivity to Cytokinin.
    Plant Physiol., 2016. 171(2): p. 1485-94
    [PMID:27208284]
  2. Dong H, et al.
    Ubiquitylation activates a peptidase that promotes cleavage and destabilization of its activating E3 ligases and diverse growth regulatory proteins to limit cell proliferation in Arabidopsis.
    Genes Dev., 2017. 31(2): p. 197-208
    [PMID:28167503]
  3. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  4. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]