PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G13540.1 | ||||||||
Common Name | ATMYB5, M2, MRP15.2, MYB5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 249aa MW: 27793.5 Da PI: 8.285 | ||||||||
Description | myb domain protein 5 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.8 | 9.4e-17 | 25 | 72 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEde+lv +k+ G g+W++ +++ g+ R++k+c++rw +yl AT3G13540.1 25 RGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYL 72 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 49.3 | 1.1e-15 | 79 | 123 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g T +E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l AT3G13540.1 79 GGITSDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 123 56699****************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.0E-22 | 16 | 75 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.503 | 20 | 72 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.77E-29 | 21 | 119 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-13 | 24 | 74 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.1E-15 | 25 | 72 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.11E-11 | 27 | 72 | No hit | No description |
PROSITE profile | PS51294 | 24.087 | 73 | 127 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-24 | 76 | 127 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-14 | 77 | 125 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.9E-14 | 80 | 123 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.84E-12 | 82 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0009845 | Biological Process | seed germination | ||||
GO:0010090 | Biological Process | trichome morphogenesis | ||||
GO:0010468 | Biological Process | regulation of gene expression | ||||
GO:0048354 | Biological Process | mucilage biosynthetic process involved in seed coat development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000282 | anatomy | trichome | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020021 | anatomy | integument | ||||
PO:0020108 | anatomy | suspensor | ||||
PO:0001185 | developmental stage | plant embryo globular stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MMSCGGKKPV SKKTTPCCTK MGMKRGPWTV EEDEILVSFI KKEGEGRWRS LPKRAGLLRC 60 GKSCRLRWMN YLRPSVKRGG ITSDEEDLIL RLHRLLGNRW SLIAGRIPGR TDNEIKNYWN 120 THLRKKLLRQ GIDPQTHKPL DANNIHKPEE EVSGGQKYPL EPISSSHTDD TTVNGGDGDS 180 KNSINVFGGE HGYEDFGFCY DDKFSSFLNS LINDVGDPFG NIIPISQPLQ MDDCKDGIVG 240 ASSSSLGHD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-27 | 23 | 127 | 5 | 108 | B-MYB |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 42564124 | 0.0 | ||||
Genevisible | 256985_at | 0.0 | ||||
Expression Atlas | AT3G13540 | - | ||||
AtGenExpress | AT3G13540 | - | ||||
ATTED-II | AT3G13540 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Siliques. {ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a member of the MYB family of transcriptional regulators. MYB5 act as a negative regulator of trichome branching and play a role in the correct formation of the seed coat and possibly the formation the underlying endosperm layers. Loss of function mutations have defects in seed coat mucilage and columella cells as well as trichome defects (smaller and reduced number of branches). | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G13540.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT1G71030(A), AT1G79840(A), AT2G23550(A), AT2G23580(A), AT2G37260(A) |
Interaction -- BIND ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | Description | ||||
BIND | AT1G63650 | EGL3 interacts with AtMYB5. | ||||
BIND | AT4G00480 | MYC1 (AtBHLH012) interacts with AtMYB5. | ||||
BIND | AT4G09820 | TT8 interacts with AtMYB5. |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT4G09820, AT4G00480, AT1G63650 | |||||
IntAct | Search Q38850 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G13540 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519587 | 0.0 | AY519587.1 Arabidopsis thaliana MYB transcription factor (At3g13540) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_187963.1 | 0.0 | myb domain protein 5 | ||||
Swissprot | Q38850 | 0.0 | MYB5_ARATH; Transcription repressor MYB5 | ||||
TrEMBL | A0A178VAR4 | 0.0 | A0A178VAR4_ARATH; MYB5 | ||||
STRING | AT3G13540.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G13540.1 |
Entrez Gene | 820556 |
iHOP | AT3G13540 |
wikigenes | AT3G13540 |