Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 55.7 | 1.1e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl
AT1G08810.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
79******************************99************97 PP
|
2 | Myb_DNA-binding | 46.4 | 9.3e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++T+ E+ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l
AT1G08810.1 67 RGNFTPHEEGMIIHLQALLGNK-WASIASYLP-QRTDNDIKNYWNTHL 112
89********************.*********.************996 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter |
GO:0009414 | Biological Process | response to water deprivation |
GO:0009416 | Biological Process | response to light stimulus |
GO:0009737 | Biological Process | response to abscisic acid |
GO:0009751 | Biological Process | response to salicylic acid |
GO:0009753 | Biological Process | response to jasmonic acid |
GO:0010118 | Biological Process | stomatal movement |
GO:0030154 | Biological Process | cell differentiation |
GO:0005634 | Cellular Component | nucleus |
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding |
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Leonhardt N, et al.
Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant. Plant Cell, 2004. 16(3): p. 596-615 [PMID:14973164] - Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] - Cominelli E, et al.
A guard-cell-specific MYB transcription factor regulates stomatal movements and plant drought tolerance. Curr. Biol., 2005. 15(13): p. 1196-200 [PMID:16005291] - Brenner WG,Romanov GA,K
Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades. Plant J., 2005. 44(2): p. 314-33 [PMID:16212609] - Suh MC, et al.
Cuticular lipid composition, surface structure, and gene expression in Arabidopsis stem epidermis. Plant Physiol., 2005. 139(4): p. 1649-65 [PMID:16299169] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Galbiati M, et al.
Gene trap lines identify Arabidopsis genes expressed in stomatal guard cells. Plant J., 2008. 53(5): p. 750-62 [PMID:18036199] - Jung C, et al.
Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis. Plant Physiol., 2008. 146(2): p. 623-35 [PMID:18162593] - Park JS, et al.
Arabidopsis R2R3-MYB transcription factor AtMYB60 functions as a transcriptional repressor of anthocyanin biosynthesis in lettuce (Lactuca sativa). Plant Cell Rep., 2008. 27(6): p. 985-94 [PMID:18317777] - Wang FF,Lian HL,Kang CY,Yang HQ
Phytochrome B is involved in mediating red light-induced stomatal opening in Arabidopsis thaliana. Mol Plant, 2010. 3(1): p. 246-59 [PMID:19965572] - Hanada K, et al.
Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana. Mol. Biol. Evol., 2011. 28(1): p. 377-82 [PMID:20736450] - Oh JE, et al.
A dual role for MYB60 in stomatal regulation and root growth of Arabidopsis thaliana under drought stress. Plant Mol. Biol., 2011. 77(1-2): p. 91-103 [PMID:21637967] - Galbiati M, et al.
The grapevine guard cell-related VvMYB60 transcription factor is involved in the regulation of stomatal activity and is differentially expressed in response to ABA and osmotic stress. BMC Plant Biol., 2011. 11: p. 142 [PMID:22018045] - Cominelli E, et al.
DOF-binding sites additively contribute to guard cell-specificity of AtMYB60 promoter. BMC Plant Biol., 2011. 11: p. 162 [PMID:22088138] - Efroni I, et al.
Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] - Negi J, et al.
A Dof transcription factor, SCAP1, is essential for the development of functional stomata in Arabidopsis. Curr. Biol., 2013. 23(6): p. 479-84 [PMID:23453954] - Rusconi F, et al.
The Arabidopsis thaliana MYB60 promoter provides a tool for the spatio-temporal control of gene expression in stomatal guard cells. J. Exp. Bot., 2013. 64(11): p. 3361-71 [PMID:23828545] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Kim D,Ntui VO,Xiong L
Arabidopsis YAK1 regulates abscisic acid response and drought resistance. FEBS Lett., 2016. 590(14): p. 2201-9 [PMID:27264339] - Kranz HD, et al.
Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]
|