PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678460538 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 151aa MW: 16792.8 Da PI: 9.0957 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 135.2 | 2e-42 | 29 | 105 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +Cq+++C++dls ak+yhrrhkvCe hskap+v+v+g+ qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+ 678460538 29 VCQADRCSVDLSYAKTYHRRHKVCEPHSKAPAVVVAGILQRFCQQCSRFHELSEFDESKRSCRRRLAGHNERRRKNP 105 6*************************************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 5.4E-34 | 25 | 91 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.923 | 27 | 104 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.27E-39 | 29 | 108 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 5.5E-33 | 30 | 103 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MSAGAAVVII GDDDQRKMST PRKPPAAKVC QADRCSVDLS YAKTYHRRHK VCEPHSKAPA 60 VVVAGILQRF CQQCSRFHEL SEFDESKRSC RRRLAGHNER RRKNPVDNSA AEGGGGRRKG 120 GVGSGGQGEE EEEDPMRVEE NGDYNKFHVR L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 7e-37 | 24 | 103 | 5 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678460538 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011100353.1 | 1e-46 | squamosa promoter-binding protein 1-like | ||||
Swissprot | Q9S7A9 | 1e-39 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A075BS07 | 5e-49 | A0A075BS07_POGCB; Squamosa promoter binding protein-like 3 (Fragment) | ||||
STRING | VIT_12s0028g03350.t01 | 2e-43 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 6e-40 | squamosa promoter binding protein-like 5 |