PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678304985 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 150aa MW: 16759.2 Da PI: 10.4067 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 154.4 | 9.8e-48 | 1 | 126 | 31 | 169 |
YABBY 31 lfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsayn 130 +f++vtvrCGhC++llsvn+ + q l ++ +ll+++ + e v + s+s+ ++ ++ n + +p p irPPekrqrvPsayn 678304985 1 MFTIVTVRCGHCANLLSVNMGASLQPLHHLQE------FQLLKQQSMMEA----AVREGASSSKLTRFGSFHPNPPKMMP---PPIRPPEKRQRVPSAYN 87 699**************999887776654443......223333333222....23333333334444344445555544...569************** PP YABBY 131 rfikeeiqrikasnPdishreafsaaaknWahfPkihfg 169 rfi+eeiqrika+nP+ishreafs+aaknWahfP+ hfg 678304985 88 RFIREEIQRIKANNPEISHREAFSTAAKNWAHFPHTHFG 126 **************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 4.0E-52 | 1 | 126 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 2.09E-8 | 64 | 121 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 2.8E-5 | 75 | 121 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MFTIVTVRCG HCANLLSVNM GASLQPLHHL QEFQLLKQQS MMEAAVREGA SSSKLTRFGS 60 FHPNPPKMMP PPIRPPEKRQ RVPSAYNRFI REEIQRIKAN NPEISHREAF STAAKNWAHF 120 PHTHFGDGNK QGKDHHLPVA GEAANGAFGC |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678304985 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011088989.1 | 6e-63 | putative axial regulator YABBY 2 isoform X1 | ||||
Refseq | XP_011088990.1 | 6e-63 | putative axial regulator YABBY 2 isoform X1 | ||||
Swissprot | Q9XFB0 | 7e-56 | YAB2_ARATH; Putative axial regulator YABBY 2 | ||||
TrEMBL | A0A0X9RCW2 | 3e-62 | A0A0X9RCW2_MENSP; YABBY family protein 2 | ||||
STRING | Migut.D02379.1.p | 8e-59 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA381 | 24 | 163 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 1e-52 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|