PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676715348 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 94aa MW: 10722.9 Da PI: 9.249 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 26.4 | 1.2e-08 | 20 | 60 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+i + +L++l+P++ + +s K+s + +L+++++YI++L 676715348 20 DQISDLVTKLQQLIPELRRRRSDKVSASKVLQETCNYIRNL 60 68999999********889********************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50888 | 10.429 | 6 | 60 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 8.0E-9 | 20 | 74 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 3.8E-6 | 20 | 60 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 1.96E-9 | 20 | 79 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MSSRRSSRSR QSGSSRISDD QISDLVTKLQ QLIPELRRRR SDKVSASKVL QETCNYIRNL 60 HREVDDLSDR LSELLASTDD NSAEAAIIRS LLNY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269|PubMed:16786307, ECO:0000269|PubMed:23224238}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676715348 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269|PubMed:16786307}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK119110 | 1e-129 | AK119110.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL21-46-D20. | |||
GenBank | BT004686 | 1e-129 | BT004686.1 Arabidopsis thaliana At1g26948 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006303467.1 | 5e-58 | transcription factor PRE6 | ||||
Swissprot | Q8GW32 | 2e-46 | PRE6_ARATH; Transcription factor PRE6 | ||||
TrEMBL | R0IDT7 | 1e-56 | R0IDT7_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.1150s0003.1.p | 2e-57 | (Capsella grandiflora) | ||||
STRING | XP_006303467.1 | 2e-57 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM259 | 28 | 225 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 1e-44 | bHLH family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|