PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462890926 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 103aa MW: 12075.8 Da PI: 10.5843 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 107.9 | 4.9e-34 | 23 | 81 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s fprsYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+ 462890926 23 LDDGYRWRKYGQKAVKNSAFPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNHP 81 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.2E-34 | 9 | 81 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.12E-29 | 15 | 82 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.713 | 18 | 83 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.7E-39 | 23 | 82 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.5E-27 | 24 | 81 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
GRGKKKASRP RFAFQTKSEN DILDDGYRWR KYGQKAVKNS AFPRSYYRCT HHTCNVKKQV 60 QRLAKDTSIV VTTYEGVHNH PCEKLMEALT PILRQLQFLS QFQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-27 | 13 | 80 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-27 | 13 | 80 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462890926 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ840412 | 1e-104 | DQ840412.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 13 (WRKY13) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020160818.1 | 8e-69 | probable WRKY transcription factor 75 | ||||
Swissprot | Q8VWQ4 | 1e-56 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | A0A3B5Y5P3 | 6e-69 | A0A3B5Y5P3_WHEAT; Uncharacterized protein | ||||
STRING | Traes_1AL_0404BC790.1 | 9e-70 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1100 | 38 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 4e-59 | WRKY DNA-binding protein 56 |