![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 28492.m000489 | ||||||||
Common Name | RCOM_0260450 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 58aa MW: 6690.71 Da PI: 4.939 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 52.1 | 2.2e-16 | 10 | 56 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 lppGfrF P+deelv++yL kk++++++ ++ e+d++++ePw+Lp 28492.m000489 10 LPPGFRFYPSDEELVCHYLYKKITNEEVLK-GTLVEIDLHTCEPWQLP 56 79************************9655.78**************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.29E-18 | 8 | 58 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 20.137 | 10 | 58 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.1E-8 | 11 | 53 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 58 aa Download sequence Send to blast |
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KITNEEVLKG TLVEIDLHTC EPWQLPGR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 28492.m000489 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KR605232 | 2e-65 | KR605232.1 Manihot esculenta NAC transcription factors 94 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021630142.1 | 3e-36 | protein CUP-SHAPED COTYLEDON 3-like | ||||
Swissprot | O04017 | 7e-16 | NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2 | ||||
TrEMBL | A0A218X9W8 | 2e-35 | A0A218X9W8_PUNGR; Uncharacterized protein | ||||
TrEMBL | B9SV35 | 9e-36 | B9SV35_RICCO; Uncharacterized protein | ||||
STRING | XP_006479521.1 | 2e-35 | (Citrus sinensis) | ||||
STRING | cassava4.1_033050m | 1e-35 | (Manihot esculenta) | ||||
STRING | XP_002529854.1 | 2e-36 | (Ricinus communis) | ||||
STRING | XP_006443820.1 | 2e-35 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF17202 | 7 | 7 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28530.2 | 5e-24 | NAC domain containing protein 74 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 28492.m000489 |