PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC7BG011730.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 60aa MW: 7137.16 Da PI: 7.8593 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 29.3 | 1e-09 | 2 | 54 | 321 | 373 |
GRAS 321 eaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 +aG++++pl+ +++ ++ +r+++ + + ++ ++++l++gWk+r L+++S W TRIDC7BG011730.4 2 RAGLRQLPLDPEVVGMVREKVREHYHKDFLIDVDHQWLLQGWKGRVLYALSTW 54 89***********************888************************* PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 60 aa Download sequence |
RRAGLRQLPL DPEVVGMVRE KVREHYHKDF LIDVDHQWLL QGWKGRVLYA LSTWVADHDS |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37650.1 | 1e-18 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC7BG011730.4 |